TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08321 XX ID T08321 XX DT 20.12.2005 (created); ili. DT 10.02.2015 (updated); ros. CO Copyright (C), QIAGEN. XX FA p53-isoform1 XX SY ASp53; NSp53; p53; p53-isoform1; p53alpha; p53as; RSp53. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G001075 TP53; HGNC: tp53. XX CL C0057; P53; 6.3.1.0.1.1. XX SZ 393 AA; 43.6 kDa (cDNA) (calc.), 53 kDa (SDS) XX SQ MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP SQ DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK SQ SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE SQ RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS SQ SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP SQ PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG SQ GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD XX SC translated from EMBL #X02469 XX FT 1 52 Mdm-2-binding [12]. FT 15 15 serine phosphorylated by DNA-PK [8]. FT 37 37 serine phosphorylated by DNA-PK [8]. FT 43 73 trans-activation domain 2 [3]. FT 93 160 transcription inhibition region [11]. FT 94 293 T_Ag binding [10]. FT 95 289 PF00870; P53 DNA-binding domain. FT 161 223 interaction with CTF2 [43]. FT 315 315 serine phosphorylated by p34cdc2 kinase [7]. FT 318 359 PF07710; P53 tetramerisation motif. FT 319 393 TBP-binding [16]. FT 338 355 required for interaction with hDaxx T02944 [42]. FT 361 382 single stranded DNA end binding region [44]. XX IN T08146 AP-2alpha; human, Homo sapiens. IN T09207 AP-2gamma-isoform1; human, Homo sapiens. IN T30879 BRD4-isoform1; human, Homo sapiens. IN T06595 C/EBPbeta-FL; human, Homo sapiens. IN T06596 C/EBPbeta-LIP; human, Homo sapiens. IN T15118 CBP; Mammalia. IN T16138 DEC1; Mammalia. IN T09117 E2F-1; human, Homo sapiens. IN T09570 E2F-1; Mammalia. IN T00305 GATA-1; mouse, Mus musculus. IN T08907 hnRNPK-isoform1; human, Homo sapiens. IN T08296 Kaiso; human, Homo sapiens. IN T09169 mtTFA-isoform1; human, Homo sapiens. IN T08321 p53-isoform1; human, Homo sapiens. IN T09500 p53; Mammalia. IN T09092 PC4; human, Homo sapiens. IN T34370 RN3; human, Homo sapiens. IN T10717 RPA1; human, Homo sapiens. IN T25716 RPA1; human, Homo sapiens. IN T10718 RPA2; human, Homo sapiens. IN T08256 SRC-1A; human, Homo sapiens. IN T04640 SRC3; human, Homo sapiens. IN T09154 SRC3; mouse, Mus musculus. XX MX M00761 V$P53DECAMER_Q2. MX M00034 V$P53_01. MX M00272 V$P53_02. MX M01651 V$P53_03. MX M01652 V$P53_04. MX M07053 V$P53_Q3. MX M07054 V$P53_Q3_01. XX BS R11699. BS R11279. BS R11280. BS R16690. BS R11272. BS R11770. BS R11283. BS R04373. BS R11275. BS R16694. BS R19321. BS R19322. BS R19355. BS R19356. BS R15809. BS R16322. BS R15810. BS R16321. BS R11723. BS R11271. BS R11626. BS R11700. BS R11388. BS R11389. BS R11385. BS R11703. BS R15811. BS R15812. BS R16836. BS R16302. BS R11722. BS R17122. BS R11638. BS R16705. BS R16703. BS R11639. BS R16317. BS R11724. BS R15815. BS R16770. BS R16693. BS R11431. BS R11316. BS R11430. BS R11446. BS R15356. BS R16310. BS R16311. BS R16320. BS R11702. BS R11270. XX DR TRANSPATH: MO000056623. DR SMARTDB: SB000116. DR EMBL: K03199; HSP53T. DR EMBL: X01405; HSP53R. DR EMBL: X02469; HSP53. DR UniProtKB: P04637-1; DR PDB: 1olg. DR PDB: 1olh. DR PDB: 1pes. DR PDB: 1pet. DR PDB: 1sae. DR PDB: 1saf. DR PDB: 1sag. DR PDB: 1sah. DR PDB: 1sai. DR PDB: 1sak. DR PDB: 1sal. DR PDB: 1tup. XX RN [1]; RE0000975. RX PUBMED: 8428901. RA Truant R., Xiao H., Ingles C. J., Greenblatt J. RT Direct interaction between the transcriptional activation domain of human p53 and the TATA box-binding protein RL J. Biol. Chem. 268:2284-2287 (1993). RN [2]; RE0005386. RX PUBMED: 8276238. RA Pavletich N. P., Chambers K. A., Pabo C. O. RT The DNA-binding domain of p53 contains the four conserved regions and the major mutation hot spots RL Genes Dev. 7:2556-2564 (1993). RN [3]; RE0005399. RX PUBMED: 7559631. RA Chang J., Kim D.-H., Lee S. W., Choi K. Y., Sung Y. C. RT Transactivation ability of p53 transcriptional activation domain is directly related to the binding affinity to TATA-binding protein RL J. Biol. Chem. 270:25014-25019 (1995). RN [4]; RE0005410. RX PUBMED: 2144363. RA Fields S., Jang S. K. RT Presence of a potent transcription activation sequence in the p53 protein RL Science 249:1046-1049 (1990). RN [5]; RE0005420. RX PUBMED: 1923804. RA Foord O. S., Bhattacharya P., Reich Z., Rotter V. RT A DNA binding domain is contained in the C-terminus of wild-type p53 protein RL Nucleic Acids Res. 19:5191-5198 (1991). RN [6]; RE0005433. RX PUBMED: 1314165. RA Unger T., Nau M. M., Segal S., Minna J. D. RT p53: A transdominant regulator of transcription whose function is ablated by mutations occurring in human cancer RL EMBO J. 11:1383-1390 (1992). RN [7]; RE0005444. RX PUBMED: 2141171. RA Bischoff J. R., Friedman P. N., Marshak D. R., Prives C., Beach D. RT Human p53 is phosphorylated by p60-cdc2 and cyclin B-cdc2 RL Proc. Natl. Acad. Sci. USA 87:4766-4770 (1990). RN [8]; RE0005449. RX PUBMED: 1406679. RA Lees-Miller S. P., Sakaguchi K., Ullrich S. J., Appella E., Anderson C. W. RT Human DNA-activated protein kinase phosphorylates serines 15 and 37 in the amino-terminal transactivation domain of human p53. RL Mol. Cell. Biol. 12:5041-5049 (1992). RN [9]; RE0005453. RX PUBMED: 8361542. RA Dutta A., Ruppert J. M., Aster J. C., Winchester E. RT Inhibition of DNA replication factor RPA by p53 RL Nature 365:79-82 (1993). RN [10]; RE0005456. RX PUBMED: 8388547. RA Ruppert J. M., Stillman B. RT Analysis of a protein-binding domain of p53 RL Mol. Cell. Biol. 13:3811-3820 (1993). RN [11]; RE0005457. RX PUBMED: 8497252. RA Liu X., Miller C. W., Koeffler P. H., Berk A. J. RT The p53 activation domain binds the TATA box-binding polypeptide in holo-TFIID, and a neighboring p53 domain inhibits transcription RL Mol. Cell. Biol. 13:3291-3300 (1993). RN [12]; RE0005458. RX PUBMED: 7686617. RA Chen J., Marechal V., Levine A. J. RT Mapping of the p53 and mdm-2 interaction domains RL Mol. Cell. Biol. 13:4107-4114 (1993). RN [13]; RE0005464. RX PUBMED: 8276240. RA Wang Y., Reed M., Wang P., Stenger J. E., Mayr G., Anderson M. E., Schwedes J. F., Tegtmeyer P. RT p53 domains: identification and characterization of two autonomous DNA-binding regions RL Genes Dev. 7:2575-2586 (1993). RN [14]; RE0005474. RX PUBMED: 8090755. RA Sakamoto H., Lewis M. S., Kodama H., Appella E., Sakaguchi K. RT Specific sequences from the carboxal terminus of human p53 gene product form anti-parallel tetramers in solution RL Proc. Natl. Acad. Sci. USA 91:8974-8978 (1994). RN [15]; RE0005477. RX PUBMED: 8035799. RA Wang P., Reed M., Wang W., Mayr G., Stenger J. E., Anderson M. E., Schwedes J. F., Tegtmeyer P. RT p53 domains: Structure, oligomerization, and transformation RL Mol. Cell. Biol. 14:5182-5191 (1994). RN [16]; RE0005480. RX PUBMED: 7799929. RA Horikoshi N., Usheva A., Chen J., Levine A. J., Weinmann R., Shenk T. RT Two domains of p53 interact with the TATA-binding protein, and the adenovirus 13S E1A protein disrupts the association, relieving p53-mediated transcriptional repression RL Mol. Cell. Biol. 15:227-234 (1995). RN [17]; RE0005481. RX PUBMED: 7859740. RA Waterman J. L. F., Shenk J. L., Halazonetis T. D. RT The dihedral symmetry of the p53 tetramerization domain mandates a conformational switch upon DNA binding RL EMBO J. 14:512-519 (1995). RN [18]; RE0027548. RX PUBMED: 10608806. RA Kim S. T., Lim D. S., Canman C. E., Kastan M. B. RT Substrate specificities and identification of putative substrates of ATM kinase family members. RL J. Biol. Chem. 274:37538-43 (1999). RN [19]; RE0047879. RX PUBMED: 9121469. RA Miller S. D., Moses K., Jayaraman L., Prives C. RT Complex formation between p53 and replication protein A inhibits the sequence-specific DNA binding of p53 and is regulated by single-stranded DNA. RL Mol. Cell. Biol. 17:2194-2201 (1997). RN [20]; RE0047883. RX PUBMED: 14966284. RA Banerjee S., Kumar B. R., Kundu T. K. RT General transcriptional coactivator PC4 activates p53 function. RL Mol. Cell. Biol. 24:2052-2062 (2004). RN [21]; RE0048011. RX PUBMED: 10551785. RA Lee S. K., Kim H. J., Kim J. W., Lee J. W. RT Steroid receptor coactivator-1 and its family members differentially regulate transactivation by the tumor suppressor protein p53. RL Mol. Endocrinol. 13:1924-1933 (1999). RN [22]; RE0048014. RX PUBMED: 12226108. RA McPherson L. A., Loktev A. V., Weigel R. J. RT Tumor suppressor activity of AP2alpha mediated through a direct interaction with p53. RL J. Biol. Chem. 277:45028-45033 (2002). RN [23]; RE0048017. RX PUBMED: 12839966. RA Yoshida Y., Izumi H., Torigoe T., Ishiguchi H., Itoh H., Kang D., Kohno K. RT P53 physically interacts with mitochondrial transcription factor A and differentially regulates binding to damaged DNA. RL Cancer Res. 63:3729-3734 (2003). RN [24]; RE0048018. RX PUBMED: 15186775. RA An W., Kim J., Roeder R. G. RT Ordered cooperative functions of PRMT1, p300, and CARM1 in transcriptional activation by p53. RL Cell 117:735-748 (2004). RN [25]; RE0048023. RX PUBMED: 10930427. RA Kim I. S., Kim D. H., Han S. M., Chin M. U., Nam H. J., Cho H. P., Choi S. Y., Song B. J., Kim E. R., Bae Y. S., Moon Y. H. RT Truncated form of importin alpha identified in breast cancer cell inhibits nuclear import of p53. RL J. Biol. Chem. 275:23139-23145 (2000). RN [26]; RE0048032. RX PUBMED: 15867353. RA Cho Y. Y., He Z., Zhang Y., Choi H. S., Zhu F., Choi B. Y., Kang B. S., Ma W. Y., Bode A. M., Dong Z. RT The p53 protein is a novel substrate of ribosomal S6 kinase 2 and a critical intermediary for ribosomal S6 kinase 2 and histone H3 interaction. RL Cancer Res. 65:3596-3603 (2005). RN [27]; RE0048275. RX PUBMED: 16227626. RA Schneider-Merck T., Pohnke Y., Kempf R., Christian M., Brosens J. J., Gellersen B. RT Physical interaction and mutual transrepression between CCAAT/enhancer-binding protein beta and the p53 tumor suppressor. RL J. Biol. Chem. 281:269-278 (2006). RN [28]; RE0048288. RX PUBMED: 14523002. RA Watcharasit P., Bijur G. N., Song L., Zhu J., Chen X., Jope R. S. RT Glycogen synthase kinase-3beta (GSK3beta) binds to and promotes the actions of p53. RL J. Biol. Chem. 278:48872-48879 (2003). RN [29]; RE0048533. RX PUBMED: 16531411. RA Sayan B. S., Sayan A. E., Knight R. A., Melino G., Cohen G. M. RT p53 is cleaved by caspases generating fragments localizing to mitochondria. RL J. Biol. Chem. 281:13566-13573 (2006). RN [30]; RE0049005. RX PUBMED: 16037820. RA Fogal V., Hsieh J. K., Royer C., Zhong S., Lu X. RT Cell cycle-dependent nuclear retention of p53 by E2F1 requires phosphorylation of p53 at Ser315. RL EMBO J. 24:2768-2782 (2005). RN [31]; RE0049500. RX PUBMED: 16446403. RA Chan W. M., Mak M. C., Fung T. K., Lau A., Siu W. Y., Poon R. Y. RT Ubiquitination of p53 at multiple sites in the DNA-binding domain. RL Mol. Cancer Res. 4:15-25 (2006). RN [32]; RE0049668. RX PUBMED: 10562557. RA Rodriguez M. S., Desterro J. M., Lain S., Midgley C. A., Lane D. P., Hay R. T. RT SUMO-1 modification activates the transcriptional response of p53. RL EMBO J. 18:6455-6461 (1999). RN [33]; RE0049963. RX PUBMED: 12724314. RA Wang Y. H., Tsay Y. G., Tan B. C., Lo W. Y., Lee S. C. RT Identification and characterization of a novel p300-mediated p53 acetylation site, lysine 305. RL J. Biol. Chem. 278:25568-25576 (2003). RN [34]; RE0054726. RX PUBMED: 17666403. RA Tripathi V., Ali A., Bhat R., Pati U. RT CHIP chaperones wild type p53 tumor suppressor protein. RL J. Biol. Chem. 282:28441-28454 (2007). RN [35]; RE0065167. RX PUBMED: 19377469. RA Tian C., Xing G., Xie P., Lu K., Nie J., Wang J., Li L., Gao M., Zhang L., He F. RT KRAB-type zinc-finger protein Apak specifically regulates p53-dependent apoptosis. RL Nat. Cell Biol. 11:580-591 (2009). RN [36]; RE0067468. RX PUBMED: 19619542. RA Okamoto K., Taya Y., Nakagama H. RT Mdmx enhances p53 ubiquitination by altering the substrate preference of the Mdm2 ubiquitin ligase. RL FEBS Lett. 583:2710-2714 (2009). RN [37]; RE0068556. RX PUBMED: 19508870. RA Sperandio S., Tardito S., Surzycki A., Latterich M., de Belle I. RT TOE1 interacts with p53 to modulate its transactivation potential. RL FEBS Lett. 583:2165-2170 (2009). RN [38]; RE0068557. RX PUBMED: 18485870. RA Tang Y., Zhao W., Chen Y., Zhao Y., Gu W. RT Acetylation is indispensable for p53 activation. RL Cell 133:612-626 (2008). RN [39]; RE0068660. RX PUBMED: 20228809. RA Drost J., Mantovani F., Tocco F., Elkon R., Comel A., Holstege H., Kerkhoven R., Jonkers J., Voorhoeve P. M., Agami R., Del Sal G. RT BRD7 is a candidate tumour suppressor gene required for p53 function. RL Nat. Cell Biol. 12:380-389 (2010). RN [40]; RE0069450. RX PUBMED: 21245319. RA Liu X., Wang D., Zhao Y., Tu B., Zheng Z., Wang L., Wang H., Gu W., Roeder R. G., Zhu W. G. RT Methyltransferase Set7/9 regulates p53 activity by interacting with Sirtuin 1 (SIRT1). RL Proc. Natl. Acad. Sci. USA 108:1925-1930 (2011). RN [41]; RE0070169. RX PUBMED: 20123963. RA Kodama M., Otsubo C., Hirota T., Yokota J., Enari M., Taya Y. RT Requirement of ATM for rapid p53 phosphorylation at Ser46 without Ser/Thr-Gln sequences. RL Mol. Cell. Biol. 30:1620-1633 (2010). RN [42]; RE0035196. RX PUBMED: 15339933. RA Gostissa M., Morelli M., Mantovani F., Guida E., Piazza S., Collavin L., Brancolini C., Schneider C., Del Sal G. RT The transcriptional repressor hDaxx potentiates p53-dependent apoptosis. RL J. Biol. Chem. 279:48013-48023 (2004). RN [43]; RE0024885. RX PUBMED: 12534345. RA Uramoto H., Izumi H., Nagatani G., Ohmori H., Nagasue N., Ise T., Yoshida T., Yasumoto K., Kohno K. RT Physical interaction of tumour suppressor p53/p73 with CCAAT-binding transcription factor 2 (CTF2) and differential regulation of human high-mobility group 1 (HMG1) gene expression. RL Biochem. J. 371:301-310 (2003). RN [44]; RE0013246. RX PUBMED: 8836183. RA Selivanova G., Iotsova V., Kiseleva E., Stroem M., Bakalkin G., Grafstroem R. C., Wiman K. G. RT The single-stranded DNA end binding site of p53 coincides with the C-terminal regulatory region RL Nucleic Acids Res. 24:3560-3567 (1996). XX //