TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09092 XX ID T09092 XX DT 16.06.2006 (created); ran. DT 17.08.2006 (updated); sri. CO Copyright (C), QIAGEN. XX FA PC4 XX SY p14; p15; PC4; positive cofactor 4. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006537 SUB1; HGNC: SUB1. XX SZ 127 AA; 14.4 kDa (cDNA) (calc.), 19 kDa (SDS) [3] XX SQ MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRD SQ DNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDI SQ DDAVRKL XX SC Swiss-Prot#P53999 XX FT 34 124 PF02229; Transcriptional Coactivator p15 (PC4). XX IN T01042 HSF1-L; human, Homo sapiens. IN T09196 HSF2A; human, Homo sapiens. IN T08321 p53-isoform1; human, Homo sapiens. XX DR TRANSPATH: MO000083138. DR EMBL: U12979; DR EMBL: X79805; DR UniProtKB: P53999; XX RN [1]; RE0005547. RX PUBMED: 1889091. RA Meisterernst M., Roy A. L., Lieu H. M., Roeder R. G. RT Activation of class II gene transcription by regulatory factors is potentiated by a novel activity RL Cell 66:981-993 (1991). RN [2]; RE0005616. RX PUBMED: 7809103. RA Ge H., Zhao Y., Chait B. T., Roeder R. G. RT Phosphorylation negatively regulates the function of coactivator PC4 RL Proc. Natl. Acad. Sci. USA 91:12691-12695 (1994). RN [3]; RE0005617. RX PUBMED: 8062391. RA Ge H., Roeder R. G. RT Purification, cloning, and characterization of a human coactivator, PC4, that mediates transcriptional activation of class II genes RL Cell 78:513-523 (1994). RN [4]; RE0005619. RX PUBMED: 8062392. RA Kretzschmar M., Kaiser K., Lottspeich F., Meisterernst M. RT A novel mediator of class I gene transcription with homology to viral immediate-early transcriptional regulators RL Cell 78:525-534 (1994). RN [5]; RE0005621. RX PUBMED: 7628453. RA Kaiser K., Stelzer G., Meisterernst M. RT The coactivator p15 (PC4) initiates transcriptional activation during TFIIA-TFIID-promoter complex formation RL EMBO J. 14:3520-3527 (1995). RN [6]; RE0031850. RX PUBMED: 11005381. RA Yuan C. X., Gurley W. B. RT Potential targets for HSF1 within the preinitiation complex. RL Cell Stress Chaperones 5:229-42 (2000). RN [7]; RE0047883. RX PUBMED: 14966284. RA Banerjee S., Kumar B. R., Kundu T. K. RT General transcriptional coactivator PC4 activates p53 function. RL Mol. Cell. Biol. 24:2052-2062 (2004). XX //