AC T09117
XX
ID T09117
XX
DT 26.07.2006 (created); jag.
DT 07.01.2016 (updated); ros.
CO Copyright (C), QIAGEN.
XX
FA E2F-1
XX
SY adenovirus E2 gene binding Factor 1; E2F transcription factor 1; E2F-1; E2F1; RBB3; RBBP3; RBP3.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G001150 E2F1; HGNC: E2F1.
XX
CL C0023; fork head.
XX
SZ 437 AA; 46.9 kDa (cDNA) (calc.), 54 kDa (SDS) [2] [1], 60 kDa (SDS) [3] [4] [4] [3] [1] [2]
XX
SQ MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
SQ PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SQ SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
SQ AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
SQ QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
SQ ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
SQ RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
SQ IRDLFDCDFGDLTPLDF
XX
SC Swiss-Prot#Q01094
XX
FT 127 192 
PF02319; E2F/DP family winged-helix DNA-binding domai.
XX
FF Act as a transcriptional repressor of the miR-223 [36];
XX
IN T19002 BRAF35; human, Homo sapiens.
IN T04074 brca1; human, Homo sapiens.
IN T06570 Dnmt1; human, Homo sapiens.
IN T33307 DNTTIP1; human, Homo sapiens.
IN T01548 DP-1; human, Homo sapiens.
IN T03000 DP-2; human, Homo sapiens.
IN T03414 Miz-1; human, Homo sapiens.
IN T02186 MO15; human, Homo sapiens.
IN T01804 NF-YA; human, Homo sapiens.
IN T06148 p/CAF; human, Homo sapiens.
IN T23091 p300; Mammalia.
IN T08321 p53-isoform1; human, Homo sapiens.
IN T00722 pRb; human, Homo sapiens.
IN T01423 pRb; mouse, Mus musculus.
IN T25008 pRb; Mammalia.
IN T16158 RING1B; human, Homo sapiens.
IN T08484 Sp1-isoform1; human, Homo sapiens.
IN T00752 Sp1; mouse, Mus musculus.
IN T08326 Sp1; Mammalia.
IN T19382 TZFP; human, Homo sapiens.
IN T18921 ZFPM2; human, Homo sapiens.
XX
MX M00428 V$E2F1_Q3.
MX M00938 V$E2F1_Q3_01.
MX M00430 V$E2F1_Q4.
MX M07250 V$E2F1_Q4_01.
MX M08874 V$E2F1_Q4_02.
MX M00431 V$E2F1_Q6.
MX M00024 V$E2F_01.
MX M00050 V$E2F_02.
MX M00516 V$E2F_03.
MX M00803 V$E2F_Q2.
MX M00918 V$E2F_Q3_01.
MX M00919 V$E2F_Q4_01.
MX M00939 V$E2F_Q4_02.
MX M08875 V$E2F_Q4_03.
MX M00920 V$E2F_Q6_01.
XX
BS R05828.
BS R15444.
BS R22101.
BS R40145.
BS R35938.
BS R09603.
BS R09604.
BS R25508.
BS R25523.
BS R09627.
BS R09628.
BS R61948.
BS R25479.
BS R25832.
BS R25834.
BS R39073.
BS R39074.
BS R64562.
BS R25908.
BS R40134.
BS R25481.
BS R63718.
BS R63719.
BS R39487.
BS R33845.
BS R33847.
BS R25497.
BS R25498.
BS R08635.
BS R61546.
BS R61547.
BS R08860.
BS R08861.
BS R08862.
BS R40147.
BS R25836.
BS R09581.
BS R09582.
BS R09583.
BS R16308.
BS R16309.
BS R40144.
XX
DR TRANSPATH: MO000083592.
DR TRANSCOMPEL: C00580.
DR EMBL: M96577;
DR EMBL: S49592;
DR EMBL: S74230;
DR EMBL: U47675;
DR EMBL: U47676;
DR EMBL: U47677;
DR UniProtKB: Q01094;
XX
RN [1]; RE0000163.
RX PUBMED: 1828392.
RA Chellappan S. P., Hiebert S., Mudryj M., Horowitz J. M., Nevins J. R.
RT The E2F transcription factor is a cellular target for the RB protein
RL Cell 65:1053-1061 (1991).
RN [2]; RE0001236.
RX PUBMED: 2523514.
RA Yee A. S., Raychaudhuri P., Jakoi L., Nevins J. R.
RT The Adenovirus-Inducible Factor E2F Stimulates Transcription after Specific DNA Binding
RL Mol. Cell. Biol. 9:578-585 (1989).
RN [3]; RE0003281.
RX PUBMED: 1638635.
RA Kaelin W. G., Krek W., Sellers W. R., DeCaprio J. A., Ajchenbaum F., fuchs C. S., Chittenden T., Blanar M. A., Livingston D. M., Flemington E. K.
RT Expression cloning of a cDNA encoding a retinoblastoma-binding protein with E2F-like properties
RL Cell 70:351-364 (1992).
RN [4]; RE0003282.
RX PUBMED: 1638634.
RA Helin K., Lees J. A., Vidal M., Dyson N., Fattaey A.
RT A cDNA encoding a pRB-binding protein with properties of the transcription factor E2F
RL Cell 70:337-350 (1992).
RN [5]; RE0003284.
RX PUBMED: 1448092.
RA Shan B., Zhu X., Chen P.-L., Durfee T., Yang Y., Sharp D., Lee W.-H.
RT Molecular cloning of cellular genes encoding retinoblastoma-associated proteins: identification of a gene with properties of the transcription factor E2F
RL Mol. Cell. Biol. 12:5620-5631 (1992).
RN [6]; RE0003294.
RX PUBMED: 8255752.
RA Hagemeier C., Cook A., Kouzarides T.
RT The retinoblastoma protein binds E2F residues required for activation in vivo and TBP binding in vitro
RL Nucleic Acids Res. 21:4998-5004 (1993).
RN [7]; RE0003299.
RX PUBMED: 7969176.
RA Xu M., Sheppard K. A., Peng C.-Y., Yee A. S., Piwnica-Worms H.
RT Cyclin A/CDK2 binds directly to E2F-1 and inhibits the DNA-binding activity of E2F-1/DP-1 by phosphorylation
RL Mol. Cell. Biol. 14:8420-8431 (1994).
RN [8]; RE0003300.
RX PUBMED: 8248803.
RA Krek W., Livingston D. M., Shirodkar S.
RT Binding to DNA and the retinoblastoma gene product promoted by complex formation of different E2F family members
RL Science 262:1557-1560 (1993).
RN [9]; RE0003306.
RX PUBMED: 7935380.
RA Neuman E., Flemington E. K., Sellers W. R., Kaelin jr W. G.
RT Transcription of the E2F-1 gene is rendered cell cycle dependent by E2F DNA-binding sites within its promoter
RL Mol. Cell. Biol. 14:6607-6615 (1994).
RN [10]; RE0003308.
RX PUBMED: 8087847.
RA Fagan R., Flint K. J., Jones N.
RT Phosphorylation of E2F-1 modulates its interaction with the retinoblastoma gene product and the adenoviral E4 19 kDa protein
RL Cell 78:799-811 (1994).
RN [11]; RE0003309.
RX PUBMED: 8045262.
RA Singh P., Wong S. H., Hong W.
RT Overexpression of E2F-1 in rat embryo fibroblasts leads to neoplastic transformation
RL EMBO J. 13:3329-3338 (1994).
RN [12]; RE0003310.
RX PUBMED: 7958856.
RA Dynlacht B. D., Flores O., Lees J. A., Harlow E.
RT Differential regulation of E2F trans-activation by cyclin/cdk2 complexes
RL Genes Dev. 8:1772-1786 (1994).
RN [13]; RE0003311.
RX PUBMED: 7958837.
RA Hsiao K. M., McMahon S. L., Farnham P. J.
RT Multiple DNA elements are required for the growth regulation of the mouse E2F1 promoter
RL Genes Dev. 8:1526-1537 (1994).
RN [14]; RE0003312.
RX PUBMED: 8206919.
RA Dimri G. P., Hara E., Campisi J.
RT Regulation of two E2F-related genes in presenescent and senescent human fibroblasts
RL J. Biol. Chem. 269:16180-16186 (1994).
RN [15]; RE0003313.
RX PUBMED: 7958836.
RA Johnson D. G., Ohtani K., Nevins J. R.
RT Autoregulatory control of E2F1 expression in response to positive and negative regulators of cell cycle progression
RL Genes Dev. 8:1514-1525 (1994).
RN [16]; RE0003314.
RX PUBMED: 8033208.
RA Krek W., Ewen M. E., Shirodkar S., Arany Z., Kaelin jr W. G., Livingston D. M.
RT Negative regulation of the growth-promoting transcription factor E2F-1 by a stably bound cyclin A-dependent protein kinase
RL Cell 78:161-172 (1994).
RN [17]; RE0003545.
RX PUBMED: 7809128.
RA Johnson D. G., Cress W. D., Jakoi L., Nevins J. R.
RT Oncogenic capacity of the E2F1 gene
RL Proc. Natl. Acad. Sci. USA 91:12823-12827 (1994).
RN [18]; RE0012605.
RX PUBMED: 8657117.
RA Moberg K., Starz M. A., Lees J. A.
RT E2F-4 switches from p130 to p107 and pRB in response to cell cycle reentry
RL Mol. Cell. Biol. 16:1436-1449 (1996).
RN [19]; RE0012787.
RX PUBMED: 8657141.
RA Karlseder J., Rotheneder H., Wintersberger E.
RT Interaction of Sp1 with the growth- and cell cycle regulated transcription factor E2F
RL Mol. Cell. Biol. 16:1659-1667 (1996).
RN [20]; RE0014167.
RX PUBMED: 9418871.
RA Hayes S., Shiyanov P., Chen X., Raychaudhuri P.
RT DDB, a putative DNA repair protein, can function as a transcriptional partner of E2F1
RL Mol. Cell. Biol. 18:240-249 (1998).
RN [21]; RE0015322.
RX PUBMED: 10090723.
RA Zheng N., Fraenkel E., Pabo C. O., Pavletich N. P.
RT Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP
RL Genes Dev. 13:666-674 (1999).
RN [22]; RE0015891.
RX PUBMED: 10753885.
RA Marzio G., Wagener C., Gutierrez M. I., Cartwright P., Helin K., Giacca M.
RT E2F family members are differentially regulated by reversible acetylation.
RL J. Biol. Chem. 275:10887-10892 (2000).
RN [23]; RE0016344.
RX PUBMED: 11389439.
RA Moroni M. C., Hickman E. S., Denchi E. L., Caprara G., Colli E., Cecconi F., Muller H., Helin K.
RT Apaf-1 is a transcriptional target for E2F and p53.
RL Nat. Cell Biol. 3:552-558 (2001).
RN [24]; RE0020169.
RX PUBMED: 8964493.
RA NEUMAN E., SELLERS W.R.S., MCNEIL J.A., LAWRENCE J.B., KAELIN W.G. JR.
RT Structure and partial genomic sequence of the human E2F1 gene.
RL Gene 173:163-169 (1996).
RN [25]; RE0031299.
RX PUBMED: 12411495.
RA Schlisio S., Halperin T., Vidal M., Nevins J. R.
RT Interaction of YY1 with E2Fs, mediated by RYBP, provides a mechanism for specificity of E2F function.
RL EMBO J. 21:5775-86 (2002).
RN [26]; RE0037431.
RX PUBMED: 10675335.
RA Martinez-Balbas M. A., Bauer U. M., Nielsen S. J., Brehm A., Kouzarides T.
RT Regulation of E2F1 activity by acetylation
RL EMBO J. 19:662-71 (2000).
RN [27]; RE0048082.
RX PUBMED: 9244350.
RA Wang H., Shao N., Ding Q. M., Cui J., Reddy E. S., Rao V. N.
RT BRCA1 proteins are transported to the nucleus in the absence of serum and splice variants BRCA1a, BRCA1b are tyrosine phosphoproteins that associate with E2F, cyclins and cyclin dependent kinases.
RL Oncogene 15:143-157 (1997).
RN [28]; RE0048944.
RX PUBMED: 16481464.
RA Hallstrom T. C., Nevins J. R.
RT Jab1 is a specificity factor for E2F1-induced apoptosis.
RL Genes Dev. 20:613-623 (2006).
RN [29]; RE0048950.
RX PUBMED: 17050006.
RA Garcia-Alvarez G., Ventura V., Ros O., Aligue R., Gil J., Tauler A.
RT Glycogen synthase kinase-3beta binds to E2F1 and regulates its transcriptional activity.
RL Biochim. Biophys. Acta 1773:375-382 (2006).
RN [30]; RE0049005.
RX PUBMED: 16037820.
RA Fogal V., Hsieh J. K., Royer C., Zhong S., Lu X.
RT Cell cycle-dependent nuclear retention of p53 by E2F1 requires phosphorylation of p53 at Ser315.
RL EMBO J. 24:2768-2782 (2005).
RN [31]; RE0049543.
RX PUBMED: 15123636.
RA Ianari A., Gallo R., Palma M., Alesse E., Gulino A.
RT Specific role for p300/CREB-binding protein-associated factor activity in E2F1 stabilization in response to DNA damage.
RL J. Biol. Chem. 279:30830-30835 (2004).
RN [32]; RE0054655.
RX PUBMED: 11459832.
RA Lin W. C., Lin F. T., Nevins J. R.
RT Selective induction of E2F1 in response to DNA damage, mediated by ATM-dependent phosphorylation.
RL Genes Dev. 15:1833-1844 (2001).
RN [33]; RE0054706.
RX PUBMED: 10428966.
RA Vandel L., Kouzarides T.
RT Residues phosphorylated by TFIIH are required for E2F-1 degradation during S-phase.
RL EMBO J. 18:4280-4291 (1999).
RN [34]; RE0054737.
RX PUBMED: 16512785.
RA Kherrouche Z., Blais A., Ferreira E., de Launoit Y., Monte D.
RT ASK-1 (apoptosis signal-regulating kinase 1) is a direct E2F target gene.
RL Biochem. J. 396:547-556 (2006).
RN [35]; RE0066230.
RX PUBMED: 20040599.
RA Paik J. C., Wang B., Liu K., Lue J. K., Lin W. C.
RT Regulation of E2F1-induced apoptosis by the nucleolar protein RRP1B.
RL J. Biol. Chem. 285:6348-6363 (2010).
RN [36]; RE0071095.
RX PUBMED: 20029046.
RA Pulikkan J. A., Dengler V., Peramangalam P. S., Peer Zada A. A., Muller-Tidow C., Bohlander S. K., Tenen D. G., Behre G.
RT Cell-cycle regulator E2F1 and microRNA-223 comprise an autoregulatory negative feedback loop in acute myeloid leukemia.
RL Blood 115:1768-1778 (2010).
XX
//