TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09290 XX ID T09290 XX DT 04.09.2006 (created); kar. DT 08.07.2015 (updated); hna. CO Copyright (C), QIAGEN. XX FA OLIG2 XX SY BHLHB1; Olg-2; OLIG2; oligodendrocyte transcription factor 2; RK17. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009159 Olig2. XX CL C0010; bHLH. XX SZ 323 AA; 32.4 kDa (cDNA) (calc.). XX SQ MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPPELSSELRGAMG SQ ASGAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLRLKINSRERKR SQ MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH SQ HAGFHPSACGGLAHSAPLPTATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS SQ ASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQV SQ PPPHHHVSAMGAGTLPRLTSDAK XX SC translated from EMBL #AB038697 XX FT 16 308 PF00478; IMP dehydrogenase / GMP reductase domain. FT 109 163 PF00010; Helix-loop-helix DNA-binding domain. FT 109 163 PS50888; HLH. FT 114 168 SM00353; finulus. XX IN T01788 E47; mouse, Mus musculus. IN T09293 Ngn-2; mouse, Mus musculus. IN T09290 OLIG2; mouse, Mus musculus. IN T08341 Sox-10-isoform1; human, Homo sapiens. IN T08441 Sox-10; rat, Rattus norvegicus. IN T14088 Sox-8; mouse, Mus musculus. IN T09097 SRY; human, Homo sapiens. XX BS R67351. BS R67352. BS R68682. BS R68688. BS R68689. XX DR TRANSPATH: MO000086206. DR EMBL: AB038697; DR UniProtKB: Q9EQW6; XX RN [1]; RE0023814. RX PUBMED: 10719889. RA Zhou Q., Wang S., Anderson D. J. RT Identification of a novel family of oligodendrocyte lineage-specific basic helix-loop-helix transcription factors. RL Neuron 25:331-343 (2000). RN [2]; RE0023815. RX PUBMED: 11091082. RA Takebayashi H., Yoshida S., Sugimori M., Kosako H., Kominami R., Nakafuku M., Nabeshima Y. RT Dynamic expression of basic helix-loop-helix Olig family members: implication of Olig2 in neuron and oligodendrocyte differentiation and identification of a new member, Olig3. RL Mech. Dev. 99:143-148 (2000). RN [3]; RE0025491. RX PUBMED: 15604411. RA Arnett H. A., Fancy S. P., Alberta J. A., Zhao C., Plant S. R., Kaing S., Raine C. S., Rowitch D. H., Franklin R. J., Stiles C. D. RT bHLH transcription factor Olig1 is required to repair demyelinated lesions in the CNS. RL Science 306:2111-2115 (2004). RN [4]; RE0048183. RX PUBMED: 15655114. RA Lee S. K., Lee B., Ruiz E. C., Pfaff S. L. RT Olig2 and Ngn2 function in opposition to modulate gene expression in motor neuron progenitor cells. RL Genes Dev. 19:282-294 (2005). RN [5]; RE0048308. RX PUBMED: 16582099. RA Wissmuller S., Kosian T., Wolf M., Finzsch M., Wegner M. RT The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors. RL Nucleic Acids Res. 34:1735-1744 (2006). XX //