TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09354 XX ID T09354 XX DT 03.10.2006 (created); jay. DT 27.04.2010 (updated); jtr. CO Copyright (C), QIAGEN. XX FA Hex XX SY hematopoietically expressed homeobox; HEX; HHEX; Prh; PRHX. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006201 Hhex. XX CL C0006; homeo. XX SZ 271 AA; 30.0 kDa (cDNA) (calc.). XX SQ MQFPHPGPAAAPAVGVPLYAPTPLLQPAHPTPFYIDDILGRGPAAPTPTPTLPSPNSSFT SQ SLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPSGFGGPLYPFPRTVNDYTHALLRHDP SQ LGKPLLWSPFLQRPLHKRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSER SQ QVKTWFQNRRAKWRRLKQENPQSNKKDALDSLDTSCEQGQDLPSEQNKGASLDRSQCSPS SQ PASQEDPDSEISEDSDQEVDIEGDKGYFNAG XX SC translated from EMBL #Z21524 XX FT 136 196 PS50071; HOMEOBOX_2. FT 137 200 SM00389; HOX_1. FT 139 195 PF00046; Homeobox domain. XX FF Hex stimulates gene expression of ntcp via the HRE in HepG2 cells but not in COS cells [4]; XX IN T09446 c-Jun; Mammalia. IN T10510 JunB; Mammalia. IN T09447 JunD; Mammalia. IN T08441 Sox-10; rat, Rattus norvegicus. IN T02420 Sox-13; mouse, Mus musculus. IN T11097 Sox-13; human, Homo sapiens. IN T14088 Sox-8; mouse, Mus musculus. IN T00765 SRF-L; mouse, Mus musculus. IN T05114 SRF; mouse, Mus musculus. IN T09097 SRY; human, Homo sapiens. XX BS R21614. XX DR TRANSPATH: MO000088097. DR EMBL: Z21524; DR UniProtKB: P43120; XX RN [1]; RE0014567. RX PUBMED: 9389666. RA Thomas P. Q., Brown A., Beddington R. S. RT Hex: a homeobox gene revealing peri-implantation asymmetry in the mouse embryo and an early transient marker of endothelial cell precursors RL Development 125:85-94 (1998). RN [2]; RE0047860. RX PUBMED: 15242862. RA Oyama Y., Kawai-Kowase K., Sekiguchi K., Sato M., Sato H., Yamazaki M., Ohyama Y., Aihara Y., Iso T., Okamaoto E., Nagai R., Kurabayashi M. RT Homeobox protein Hex facilitates serum responsive factor-mediated activation of the SM22alpha gene transcription in embryonic fibroblasts. RL Arterioscler. Thromb. Vasc. Biol. 24:1602-1607 (2004). RN [3]; RE0048308. RX PUBMED: 16582099. RA Wissmuller S., Kosian T., Wolf M., Finzsch M., Wegner M. RT The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors. RL Nucleic Acids Res. 34:1735-1744 (2006). RN [4]; RE0050391. RX PUBMED: 10915644. RA Denson L. A., Karpen S. J., Bogue C. W., Jacobs H. C. RT Divergent homeobox gene hex regulates promoter of the Na(+)-dependent bile acid cotransporter. RL Am. J. Physiol. Gastrointest. Liver Physiol. 279:G347-55 (2000). RN [5]; RE0052694. RX PUBMED: 11551904. RA Schaefer L. K., Wang S., Schaefer T. S. RT Functional interaction of Jun and homeodomain proteins. RL J. Biol. Chem. 276:43074-43082 (2001). RN [6]; RE0066256. RX PUBMED: 20028982. RA Marfil V., Moya M., Pierreux C. E., Castell J. V., Lemaigre F. P., Real F. X., Bort R. RT Interaction between Hhex and SOX13 modulates Wnt/TCF activity. RL J. Biol. Chem. 285:5726-5737 (2010). XX //