AC T00765
XX
ID T00765
XX
DT 15.10.1992 (created); ewi.
DT 14.06.2006 (updated); kau.
CO Copyright (C), QIAGEN.
XX
FA SRF-L
XX
SY CArG-binding factor; CBF (3); p67; p67SRF; serum response factor; SRF; SRF (504 AA); SRF-L.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G002018 Srf.
XX
HO factor 1; EBF; SRF (human) T00764.
XX
CL C0014; MADS.
XX
SZ 504 AA; 51.2 kDa (cDNA) (calc.).
XX
SQ MLPSQAGAAAALGRGSALGGNLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGQSRLEREA
SQ AAAAAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMELGVVVGGPEAAAAAAGGY
SQ GPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVL
SQ LLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEEP
SQ DLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLA
SQ PVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAIHVHQ
SQ APQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLA
SQ DGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTAPSGTVQIPVSAVQLHQMAVIGQQ
SQ AGSSSNLTELQVVNLDATHSTKSE
XX
SC translated from EMBL #AB038376
XX
FT 137 196 
SM00432; MADS.
FT 137 197 
PS50066; MADS_BOX_2.
FT 145 195 
PF00319; SRF-type transcription factor (DNA-binding a.
FT 189 501 
PF00478; IMP dehydrogenase / GMP reductase domain.
XX
CP Embryo: E9,10,13,14 [9];adult: testis, liver, kidney, lung, uterus, aorta [9]; heart, sk muscle [9] [10]; kidney, spleen, stomach [11]; C2C12 un-, differentiated my oblasts, myotubes [9];rat VSMC [9];protein: P19,C2C12 myoblasts [9] [9] [10] [11].
CN Adult: liver [11].
XX
FF binds to serum response element (SRE);
FF rapid and transient induction of SRF mRNA synthesis after serum stimulation (60-480 min, somewhat delayed compared with c-fos mRNA: possible hint on SRF role in shutoff of c-fos transcription) [6];
FF progressive phosphorylation over 12 h [6];
FF SRF protein half-life >12 h [6];
FF SRF gene activation by SRF alone occurs through a PKC-independent pathway, cooperative effect with TCF is stimulated by PKC [8];
FF expression on protein level in embryo: E6.5: ectoderm, andoderm, both embryonic and extra embryonic [12];
FF E7.5: all 3 germ layers [12];
FF E8.5: high in developing heart, specific for myocardium [12];
FF E10.5: also in developing myotome [12];
FF expression on RNA level: E8.5-E12.5: two mRNA species, possibly representing differently polyadenylated variants [12];
FF Srf-/- mutation was lethal during embryogenesis, E7.5: reduced size, delayed development, late egg cylinder stage morphology, no primitive streak, no mesodermal cells [12];
FF E7.5 and E8.5: aberrant folding of both embryonic ectoderm and endoderm [12];
FF SRF is essential for mesoderm formation during gastrulation [12];
FF in SRF-/- embryos expression level of c-fos and Egr-1 is drastically reduced, alpha-actin expression was not observed [12];
FF activates with Nkx-2.5 cardiac alpha-actin transcription [13];
XX
IN T00043 Arg80p; yeast, Saccharomyces cerevisiae.
IN T05778 ASC-2; human, Homo sapiens.
IN T08796 ASC-2; human, Homo sapiens.
IN T00250 Elk-1; human, Homo sapiens.
IN T09354 Hex; mouse, Mus musculus.
IN T01413 Net; mouse, Mus musculus.
IN T00737 SAP-1a; human, Homo sapiens.
IN T02128 SAP-1b; human, Homo sapiens.
XX
MX M00152 V$SRF_01.
MX M01257 V$SRF_02.
MX M00215 V$SRF_C.
MX M07618 V$SRF_Q3.
MX M00810 V$SRF_Q4.
MX M00922 V$SRF_Q5_01.
MX M01007 V$SRF_Q5_02.
MX M00186 V$SRF_Q6.
XX
BS R09531.
BS R02129.
BS R00036.
BS R00021.
BS R00022.
BS R00024.
BS R00026.
BS R00027.
BS R01759.
BS R01757.
BS R14818.
BS R14637.
BS R00464.
BS R00466.
BS R09705.
BS R02907.
BS R01797.
BS R08490.
BS R00472.
BS R09532.
BS R09541.
BS R09533.
BS R09534.
BS R09535.
BS R02246.
BS R01890.
BS R01365.
XX
DR TRANSPATH: MO000025159.
DR EMBL: AB038376;
DR UniProtKB: Q9JM73;
XX
RN [1]; RE0000809.
RX PUBMED: 2910853.
RA Boxer L. M., Miwa T., Gustafson T. A., Kedes L.
RT Identification and Characterization of a Factor That Binds to Two Human Sarcomeric Actin Promoters
RL J. Biol. Chem. 264:1284-1292 (1989).
RN [2]; RE0001200.
RX PUBMED: 2710114.
RA Boxer L. M., Prywes R., Roeder R. G., Kedes L.
RT The Sarcomeric Actin CArG-Binding Factor Is Indistinguishable from the c-fos Serum Response Factor
RL Mol. Cell. Biol. 9:515-522 (1989).
RN [3]; RE0001201.
RX PUBMED: 3185542.
RA Gustafson T. A., Miwa T., Boxer L. M., Kedes L.
RT Interactions of Nuclear Proteins with Muscle-Specific Regulatory Sequences of the Human Cardiac alpha-Actin Promoter
RL Mol. Cell. Biol. 8:4110-4119 (1988).
RN [4]; RE0001204.
RX PUBMED: 3185543.
RA Muscat G. E. O., Gustafson T. A., Kedes L.
RT A Common Factor Regulates Skeletal and Cardiac alpha-Actin Gene Transcription in Muscle
RL Mol. Cell. Biol. 8:4120-4133 (1988).
RN [5]; RE0001374.
RX PUBMED: 2796988.
RA Gustafson T. A., Kedes L.
RT Identification of Multiple Proteins That Interact with Functional Regions of the Human Cardiac alpha-Actin Promoter
RL Mol. Cell. Biol. 9:3269-3283 (1989).
RN [6]; RE0001691.
RX PUBMED: 1875937.
RA Misra R. P., Rivera V. M., Wang J. M., Fan P.-D., Greenberg M. E.
RT The serum response factor is extensively modified by phosphorylation following its synthesis in serum-stimulated fibroblasts
RL Mol. Cell. Biol. 11:4545-4554 (1991).
RN [7]; RE0002264.
RX PUBMED: 2494661.
RA Gustafson T. A., Taylor A., Kedes L.
RT DNA bending is induced by a transcription factor that interacts with the human c-FOS and alpha-actin promoters
RL Proc. Natl. Acad. Sci. USA 86:2162-2166 (1989).
RN [8]; RE0002656.
RX PUBMED: 1898992.
RA Graham R., Gilman M.
RT Distinct protein targets for signals acting at the c-fos serum response element
RL Science 251:189-192 (1991).
RN [9]; RE0015274.
RX PUBMED: 10642500.
RA Kemp P. R., Metcalfe J. C.
RT Four isoforms of serum response factor that increase or inhibit smooth-muscle-specific promoter activity
RL Biochem. J. 345:445-451 (2000).
RN [10]; RE0015278.
RX PUBMED: 9218459.
RA Belaguli N. S., Schildmeyer L. A., Schwartz R. J.
RT Organization and myogenic restricted expression of the murine serum response factor gene. A role for autoregulation
RL J. Biol. Chem. 272:18222-18231 (1997).
RN [11]; RE0015300.
RX PUBMED: 10373507.
RA Belaguli N. S., Zhou W., Trinh T. H., Majesky M. W., Schwartz R. J.
RT Dominant negative murine serum response factor: alternative splicing within the activation domain inhibits transactivation of serum response factor binding targets
RL Mol. Cell. Biol. 19:4582-4591 (1999).
RN [12]; RE0015425.
RX PUBMED: 9799237.
RA Arsenian S., Weinhold B., Oelgeschlager M., Ruther U., Nordheim A.
RT Serum response factor is essential for mesoderm formation during mouse embryogenesis
RL EMBO J. 17:6289-6299 (1998).
RN [13]; RE0015484.
RX PUBMED: 8887666.
RA Chen C.Y., Schwartz R.J.
RT Recruitment of the tinman homolog Nkx-2.5 by serum response factor activates cardiac alpha-actin gene transcription
RL Mol. Cell. Biol. 16:6372-6384 (1996).
RN [14]; RE0047851.
RX PUBMED: 10847592.
RA Lee S. K., Na S. Y., Jung S. Y., Choi J. E., Jhun B. H., Cheong J., Meltzer P. S., Lee Y. C., Lee J. W.
RT Activating protein-1, nuclear factor-kappaB, and serum response factor as novel target molecules of the cancer-amplified transcription coactivator ASC-2.
RL Mol. Endocrinol. 14:915-925 (2000).
RN [15]; RE0047860.
RX PUBMED: 15242862.
RA Oyama Y., Kawai-Kowase K., Sekiguchi K., Sato M., Sato H., Yamazaki M., Ohyama Y., Aihara Y., Iso T., Okamaoto E., Nagai R., Kurabayashi M.
RT Homeobox protein Hex facilitates serum responsive factor-mediated activation of the SM22alpha gene transcription in embryonic fibroblasts.
RL Arterioscler. Thromb. Vasc. Biol. 24:1602-1607 (2004).
XX
//