TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00043 XX ID T00043 XX DT 12.03.1993 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Arg80p XX SY ARG80; ARG80p; ARGR1; ARGRI; YMR042W. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G091144 ARG80. XX CL C0014; MADS; F4.4.3.0.1. XX SZ 177 AA; 19.5 kDa (gene) (calc.). XX SQ MTSNSDGSSTSPVEKPITGDVETNEPTKPIRRLSTPSPEQDQEGDFDEEDDDDKFSVSTS SQ TPTPTITKTKDSSDTSTVTRRKQPIRYIENKTRRHVTFSKRRHGIMKKAYELSVLTGANI SQ LLLILANSGLVYTFTTPKLEPVVREDEGKSLIRACINASDTPDATDTSPAQEQSPAN XX SC Swiss-Prot#P07249 XX FT 78 137 SM00432; MADS. FT 78 138 PS50066; MADS_BOX_2. FT 86 136 PF00319; SRF-type transcription factor (DNA-binding a. XX SF does not interact with TCF (p62TCF) [1]; SF interacts with Mcm1p T00500and is stabilized by Arg82p T01259 [5]; SF DNA bending of the QPPAL binding site [6]; XX FF controls arginine metabolism: repressor of arginine syntheses, induces Arg catabolism [2]; XX IN T00044 Arg81p; yeast, Saccharomyces cerevisiae. IN T01259 Arg82p; yeast, Saccharomyces cerevisiae. IN T00500 Mcm1p; yeast, Saccharomyces cerevisiae. IN T00765 SRF-L; mouse, Mus musculus. IN T00761 SRF; chick, Gallus gallus. IN T00762 SRF; cat, Felis silvestris catus. IN T00763 SRF; clawed frog, Xenopus laevis. IN T00764 SRF; human, Homo sapiens. IN T00766 SRF; rat, Rattus norvegicus. XX MX M01673 F$ARGRI_01. XX BS R00466. BS R03057. XX DR EMBL: X05327; SCARGI. DR UniProtKB: P07249; ARG1_YEAST. XX RN [1]; RE0000532. RX PUBMED: 1756729. RA Mueller C. G. F., Nordheim A. RT A protein domain conserved between yeast MCM1 and human SRF directs ternary complex formation RL EMBO J. 10:4219-4229 (1991). RN [2]; RE0001618. RX PUBMED: 2005902. RA Dubois E., Messenguy F. RT In vitro studies of the binding of the ARGR proteins to the ARG5,6 promoter RL Mol. Cell. Biol. 11:2162-2168 (1991). RN [3]; RE0001688. RX PUBMED: 8417320. RA Sharrocks A. D., Gille H., Shaw P. E. RT Identification of amino acids essential for DNA binding and dimerization in p67SRF: implications for a novel DNA-binding motif RL Mol. Cell. Biol. 13:123-132 (1993). RN [4]; RE0004116. RX PUBMED: 3298999. RA Dubois E., Bercy J., Messenguy F. RT Characterization of two genes, ARGRI and ARGRIII required for specific regulation of arginine metabolism in yeast RL Mol. Gen. Genet. 207:142-148 (1987). RN [5]; RE0015874. RX PUBMED: 10632874. RA El Bakkoury M., Dubois E., Messenguy F. RT Recruitment of the yeast MADS-box proteins, ArgRI and Mcm1 by the pleiotropic factor ArgRIII is required for their stability. RL Mol. Microbiol. 35:15-31 (2000). RN [6]; RE0022791. RX PUBMED: 10064699. RA West A. G., Sharrocks A. D. RT MADS-box transcription factors adopt alternative mechanisms for bending DNA. RL J. Mol. Biol. 286:1311-1323 (1999). XX //