TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00761 XX ID T00761 XX DT 27.01.1993 (created); hse. DT 16.06.2010 (updated); pro. CO Copyright (C), QIAGEN. XX FA SRF XX SY Serum Responsive Factor; SRF. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G009824 SRF. XX CL C0014; MADS. XX SZ 375 AA; 39.0 kDa (cDNA) (calc.), 39.1 kDa (cDNA) [4] XX SQ PPPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGH SQ VYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSES SQ DSSGETKDVLKPTFTVTNLPGTTSTIQTAPTTSSSMQVSSGPSFPITNYLAPVSASISPS SQ AVTSANGTVLKTTGASAVTSGGLMQIPTGFTLMSGGTMAQQVPVQAIQVHQAPQQTSPSS SQ DSSTDLTQTSPSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLADGGLAVLNA SQ FSQTPSAMQVSHSQVQDQGGVPQVFLTAPSGTVQIPVSAVQLHQMAVIGQQSSSGSSLTE SQ LQXVNLDTSHNAKSD XX SC translated from EMBL #U50596 XX FT 8 67 SM00432; MADS. FT 8 68 PS50066; MADS_BOX_2. FT 14 321 PF00478; IMP dehydrogenase / GMP reductase domain. FT 16 66 PF00319; SRF-type transcription factor (DNA-binding a. XX SF phosphorylation; SF both DNA-binding and C-terminal transactivation domains of SRF are necessary for synergistic transcriptional regulation by SRF and GATA-4 [6]; XX CP stage 4 embryo: epiblast, blood islands [4]; stage 6 embryos: neural groove, neural plate, primitive streak, lateral plate mesoderm, underlying endoderm [4]; stage 8 embryo: neural folds, somites [4]; stage 11 embryo: neuroectoderm of brain and neural tube, developing heart, splanchnic mesoderm, somites, presomitic mesoderm [4]; embryo: day 18: brain, heart, gizzard, skeletal muscle [4]; additional in day 10 in aorta and in day 14 in 4th aortic arch and abdominal aorta [5]; upregulated in multinucleated (BudR for 60 hrs) and differentiated myotubes (84 hrs BudR) [4] [4] [5]. CN embryo: day 18 (mRNA and protein): liver [4]; in BudR replicating myoblasts [4] [4]. XX FF binds to serum response element (SRE); FF increases with myoblast differentiation; FF required for alpha-actin transcription [4]; FF activates heart myocyte-specific transcription synergistically with GATA-4 [6]; FF in contrast to transcripts SRF protein appears predominantly during cardiac morphogenesis in developing myocardium and myotome [4]; FF SRF protein was abundant in the fusing paired primordia (HH stage 8) and myocardium (HH stage 10 to HH stage 15) of developing heart [4]; FF two mRNA species that correspond to 3.5 and 2.5 kb SRF mRNA were detected from RNA extracted from day 10 and 14 embryonic tissues, due to differential 3' polyadenylation [5]; XX IN T00043 Arg80p; yeast, Saccharomyces cerevisiae. IN T00250 Elk-1; human, Homo sapiens. IN T01413 Net; mouse, Mus musculus. IN T00737 SAP-1a; human, Homo sapiens. IN T02128 SAP-1b; human, Homo sapiens. XX MX M00152 V$SRF_01. MX M01257 V$SRF_02. MX M00215 V$SRF_C. MX M07618 V$SRF_Q3. MX M00810 V$SRF_Q4. MX M00922 V$SRF_Q5_01. MX M01007 V$SRF_Q5_02. MX M00186 V$SRF_Q6. XX BS R00031. BS R14881. BS R14969. BS R14871. BS R15858. BS R04185. BS R02246. XX DR TRANSPATH: MO000025157. DR TRANSCOMPEL: C00428. DR EMBL: U50596; DR UniProtKB: Q90718; XX RN [1]; RE0001614. RX PUBMED: 2005890. RA Santoro I. M., Yi T.-M., Walsh K. RT Identification of single-stranded-DNA-binding proteins that interact with muscle gene elements RL Mol. Cell. Biol. 11:1944-1953 (1991). RN [2]; RE0002948. RX PUBMED: 1409704. RA Lee T.-C., Shi Y., Schwartz R. J. RT Displacement of BrdUrd-induced YY1 by serum response factor activates skeletal alpha-actin transcription in embryonic myoblasts RL Proc. Natl. Acad. Sci. USA 89:9814-9818 (1992). RN [3]; RE0002955. RX PUBMED: 1328862. RA Boulden A. M., Sealy L. J. RT Maximal serum stimulation of the c-fos serum response element requires both the serum response factor and a novel binding factor, SRE-binding protein RL Mol. Cell. Biol. 12:4769-4783 (1992). RN [4]; RE0014921. RX PUBMED: 8660892. RA Croissant J.D., Kim J.H., Eichele G., Goering L., Lough J., Prywes R., Schwartz R.J. RT Avian serum response factor expression restricted primarily to muscle cell lineages is required for alpha-actin gene transcription RL Dev. Biol. 177:250-264 (1996). RN [5]; RE0015323. RX PUBMED: 8900044. RA Chen C. Y., Croissant J., Majesky M., Topouzis S., McQuinn T., Frankovsky M. J., Schwartz R. J. RT Activation of the cardiac alpha-actin promoter depends upon serum response factor, Tinman homologue, Nkx-2.5, and intact serum response elements RL Dev. Genet. 19:119-130 (1996). RN [6]; RE0015397. RX PUBMED: 11038368. RA Moore M. L., Wang G. L., Belaguli N. S., Schwartz R. J., McMillin J. B. RT GATA-4 and Serum Response Factor Regulate Transcription of the Muscle-Specific Carnitine Palmitoyltransferase I {beta} in Rat Heart RL J. Biol. Chem. 276:1026-1033 (2001). XX //