TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00737 XX ID T00737 XX DT 27.10.1992 (created); ewi. DT 12.10.2011 (updated); lat. CO Copyright (C), QIAGEN. XX FA SAP-1a XX SY Elk-4; SAP-1; SAP-1a; SRF accessory protein 1; SRF accessory protein 1a; SRF Associated Protein 1a. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G007337 ELK4; HGNC: ELK4. XX HO TCF. XX CL C0016; ETS; 3.5.2.2.3.1. XX SZ 431 AA; 46.8 kDa (cDNA) (calc.), 58 kDa (SDS) XX SQ MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLS SQ RALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDV SQ ENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKS SQ PQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPT SQ SASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP SQ KDQDSVLLEKDKVNNSSRSKKPKGLGLAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQ SQ TPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPST SQ PGPFSPDLQKT XX SC Swiss-Prot#P28324-1 XX FT 4 87 PF00178; Ets-domain. FT 4 89 SM00413; etsneu2. FT 5 85 PS50061; ETS_DOMAIN_3. FT 7 75 PS50140; HSF_ETS. FT 381 381 Serin-phosphorylation by MAP kinase(-like) activity [7]. XX SF revised sequence [5]; SF a splice variant is SAP-1b; SF three regions demonstrate similarity with Elk-1, one of them (box C) largely truncated in SAP-1b [5]; SF ternary complex formation with SRE and SRF is independent of orientation and distance to the SRF site [4] [5]; SF box C may reduce ternary complex formation [5]; SF the crystal structure of the Sap-1 ETS domain bound to DNA is resolved [10]; SF X-ray structure of the Sap1-SRF-SRE ternary complex is determined [11]; SF phosphorylation-dependent activation of SAP-1a involves Ser-381, Ser-387, Thr-420 and Ser-425 [7]; XX CP K562, HeLa, Jurkat, IARC-EW17, Saos, BL2, Ramos, E418 [8]. XX FF activator; FF contacts a GGA core DNA sequence [10]; FF cooperates with SRF T00764 in activating transcription from c-fos SRE [5] [6]; FF phosphorylation by ERK2 results in increased SRF-dependent and SRF-independent DNA binding [6] [7]; FF mediates insulin-increased transcription of the prolactin gene in pituitary cells [9]; XX IN T21852 HDAC1; Mammalia. IN T00765 SRF-L; mouse, Mus musculus. IN T00761 SRF; chick, Gallus gallus. IN T00762 SRF; cat, Felis silvestris catus. IN T00763 SRF; clawed frog, Xenopus laevis. IN T00764 SRF; human, Homo sapiens. IN T00766 SRF; rat, Rattus norvegicus. XX MX M00771 V$ETS_Q4. MX M00971 V$ETS_Q6. MX M01167 V$SAP1A_01. MX M03844 V$SAP1A_Q6. XX BS R03598. BS R03600. BS R03603. BS R03604. BS R23439. BS R23442. BS R23443. BS R23444. BS R23445. BS R23446. BS R23447. BS R23448. BS R23449. BS R23450. BS R23451. BS R23452. BS R23453. BS R23454. BS R23455. BS R23456. BS R23457. BS R23458. BS R23459. BS R23460. BS R02386. BS R00040. BS R00460. BS R00466. BS R31525. BS R36824. BS R00961. BS R03582. XX DR TRANSPATH: MO000019546. DR TRANSCOMPEL: C00022. DR EMBL: M85165; HSSERREFB. DR UniProtKB: P28324-1; XX RN [1]; RE0000068. RX PUBMED: 2492906. RA Shaw P. E., Schroeter H., Nordheim A. RT The Ability of a Ternary Complex to Form Over the Serum Response Element Correlates with Serum Inducibility of the Human c-fos Promoter RL Cell 56:563-572 (1989). RN [2]; RE0000195. RX PUBMED: 1339307. RA Dalton S., Treisman R. RT Characterization of SAP-1, a protein recruited by serum response factor to the c-fos serum response element RL Cell 68:597-612 (1992). RN [3]; RE0000343. RX PUBMED: 2108863. RA Schroeter H., Mueller C. G. F., Meese K., Nordheim A. RT Synergism in ternary complex formation between the dimeric glycoprotein p67SRF, polypeptide p62TCF and the c-fos serum response element RL EMBO J. 9:1123-1130 (1990). RN [4]; RE0000531. RX PUBMED: 1425594. RA Treisman R., Marais R., Wynne J. RT Spatial flexibility in ternary complexes between SRF and its accessory proteins RL EMBO J. 11:4631-4640 (1992). RN [5]; RE0004454. RX PUBMED: 8293474. RA Dalton S., Treisman R. RT Characterization of SAP-1, a protein recruited by serum response factor to the c-fos serum response element RL Cell 76:411-411 (1994). RN [6]; RE0004468. RX PUBMED: 8668149. RA Shore P., Whitmarsh A. J., Bhaskaran R., Davis R. J., Waltho J. P., Sharrocks A. D. RT Determinants of DNA-binding specificity of ets-domain transcription factors RL Mol. Cell. Biol. 16:3338-3349 (1996). RN [7]; RE0005332. RX PUBMED: 7540136. RA Price M. A., Rogers A. E., Treisman R. RT Comparative analysis of the ternary complex factors Elk-1, SAP-1a and SAP-2 (ERP/NET) RL EMBO J. 14:2589-2601 (1995). RN [8]; RE0015517. RX PUBMED: 8764983. RA Magnaghi-Jaulin L., Masutani H., Lipinski M., Harel-Bellan A. RT Analysis of SRF, SAP-1 and ELK-1 transcripts and proteins in human cell lines RL FEBS Lett. 391:247-251 (1996). RN [9]; RE0023726. RX PUBMED: 11340077. RA Jacob K. K., Stanley F. M. RT Elk-1, C/EBPalpha, and Pit-1 confer an insulin-responsive phenotype on prolactin promoter expression in Chinese hamster ovary cells and define the factors required for insulin-increased transcription. RL J. Biol. Chem. 276:24931-24936 (2001). RN [10]; RE0024586. RX PUBMED: 9734357. RA Mo Y., Vaessen B., Johnston K., Marmorstein R. RT Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins. RL Mol. Cell 2:201-212 (1998). RN [11]; RE0024594. RX PUBMED: 11406578. RA Hassler M., Richmond T. J. RT The B-box dominates SAP-1-SRF interactions in the structure of the ternary complex. RL EMBO J. 20:3018-3028 (2001). RN [12]; RE0048074. RX PUBMED: 11283259. RA Yang S. H., Vickers E., Brehm A., Kouzarides T., Sharrocks A. D. RT Temporal recruitment of the mSin3A-histone deacetylase corepressor complex to the ETS domain transcription factor Elk-1. RL Mol. Cell. Biol. 21:2802-2814 (2001). RN [13]; RE0066975. RX PUBMED: 20145255. RA Fernandez-Alvarez A., Soledad Alvarez M., Cucarella C., Casado M. RT Characterization of the human insulin-induced gene 2 (INSIG2) promoter: the role of Ets-binding motifs. RL J. Biol. Chem. 285:11765-11774 (2010). XX //