TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01413 XX ID T01413 XX DT 11.12.1994 (created); ewi. DT 17.06.2013 (updated); sup. CO Copyright (C), QIAGEN. XX FA Net XX SY Elk-3; ERP; Net; SAP2; SRF accessory protein 2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009412 Elk3. XX CL C0016; ETS. XX SZ 409 AA; 44.5 kDa (cDNA) (calc.). XX SQ MESAITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLS SQ RALRYYYDKNIIKKVIGQKFVYKFVSFPDILKMDPHAVEISRESLLLQDGDCKVSPEGRE SQ VHRHGLSSLKSASRNEYLHSGLYSSFTINSLENAPEAFKAIKTEKLEEPCDDSPPVEEVR SQ TVIRFVTNKTDKHITRPVMSLPSTSETAAAAASAFLASSVSAKISSLMLPNAASVSSVSP SQ SSSRSPSLSPDSPLPSEHRSLFLEAACHESDSLEPLNLSSGSKTKSPSLPPKGKKPKGLE SQ ISAPQLLLSGTDIGSIALNSPALPSGSLTPAFFTAQTPSGLFLASSPLLPSIHFWSSLSP SQ VAPLSPARLQGPNTLFQFPTLLNGHMPVPLPSLDRAPSPVLLSPSSQKS XX SC translated from EMBL #Z32815 XX FT 4 87 PF00178; Ets-domain. FT 4 89 SM00413; etsneu2. FT 5 85 PS50061; ETS_DOMAIN_3. FT 7 75 PS50140; HSF_ETS. FT 132 152 B box (homology with Elk-1 and SAP-1): essential for ternary complex formation [1]. FT 345 409 inhibition of DNA-binding [1]. XX SF member of the elk subfamily of ETS factors; XX CP heart, muscle, lung; less in liver, kidney; low in brain [1], early B cells [2]; muscle, thymus, spleen, lung [5] [1] [5] [2]. CN spleen, testis [1]. XX FF repressor [1]; FF activator as a downstream target of Ras [1]; FF ternary complex formation with SRF [1] [5]; XX IN T10212 E47; Mammalia. IN T00765 SRF-L; mouse, Mus musculus. IN T00761 SRF; chick, Gallus gallus. IN T00762 SRF; cat, Felis silvestris catus. IN T00763 SRF; clawed frog, Xenopus laevis. IN T00766 SRF; rat, Rattus norvegicus. XX MX M00971 V$ETS_Q6. MX M01982 V$NET_01. MX M03832 V$NET_Q6. MX M08824 V$NET_Q6_01. XX BS R00466. BS R16781. BS R56499. BS R01224. XX DR TRANSPATH: MO000041643. DR EMBL: L19953; DR EMBL: Z32815; DR UniProtKB: P41971; XX RN [1]; RE0000802. RX PUBMED: 7958835. RA Giovane A., Pintzas A., Maira S.-M., Sobieszczuk P., Wasylyk B. RT Net, a new ets transcription factor that is activated by Ras RL Genes Dev. 8:1502-1513 (1994). RN [2]; RE0005336. RX PUBMED: 7909357. RA Lopez M., Oettgen P., Akbarali Y., Dendorfer U., Libermann T. A. RT ERP, a new member of the ets transcription factor/oncoprotein family: cloning, characterization, and differential expression during B-lymphocyte development RL Mol. Cell. Biol. 14:3292-3309 (1994). RN [3]; RE0013484. RX PUBMED: 8918463. RA Maira S. M., Wurtz J. M., Wasylyk B. RT Net (ERP/SAP2) one of the Ras-inducible TCFs, has a novel inhibitory domain with resemblance to the helix-loop-helix motif. RL EMBO J. 15:5849-5865 (1996). RN [4]; RE0024168. RX PUBMED: 14729959. RA Nakade K., Zheng H., Ganguli G., Buchwalter G., Gross C., Wasylyk B. RT The tumor suppressor p53 inhibits Net, an effector of Ras/extracellular signal-regulated kinase signaling. RL Mol. Cell. Biol. 24:1132-1142 (2004). RN [5]; RE0024210. RX PUBMED: 9315625. RA Giovane A., Sobieszczuk P., Ayadi A., Maira S. M., Wasylyk B. RT Net-b, a Ras-insensitive factor that forms ternary complexes with serum response factor on the serum response element of the fos promoter. RL Mol. Cell. Biol. 17:5667-5678 (1997). XX //