TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01259 XX ID T01259 XX DT 17.10.1994 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Arg82p XX SY ARG82; ARG82p; ARGR3; ARGRIII; YDR173C. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004203 ARG82. XX SZ 355 AA; 40.3 kDa (gene) (calc.). XX SQ MDTVNNYRVLEHKAAGHDGTLTDGDGLLIFKPAFPQELEFYKAIQVRDVSRRKSSADGDA SQ PLCSWMPTYLGVLNEGAKIEQSGDAALLKIDERLSDSTDNLDSIPVKSEKSKQYLVLENL SQ LYGFSKPNILDIKLGKTLYDSKASLEKRERMKRVSETTTSGSLGFRICGMKIQKNPSVLN SQ QLSLEYYEEEADSDYIFINKLYGRSRTDQNVSDAIELYFNNPHLSDARKHQLKKTFLKRL SQ QLFYNTMLEEEVRMISSSLLFIYEGDPERWELLNDVDKLMRDDFIDDDDDDDDNDDDDDD SQ DAEGSSEGPKDKKTTGSLSSMSLIDFAHSEITPGKGYDENVIEGVETLLDIFMKF XX SC Swiss-Prot#P07250 XX FT 1 353 PF03770; Inositol polyphosphate kinase. XX FF involved in the regulation of genes of the arginine metabolism and other processes; FF stabilizes Arg80p T00043 and Mcm1p T00500 [3]; FF interacts with these proteins via the putative alpha-helix present in the respective MADS-box domains [3]; XX IN T00043 Arg80p; yeast, Saccharomyces cerevisiae. IN T00500 Mcm1p; yeast, Saccharomyces cerevisiae. XX BS R24667. BS R24666. BS R24664. BS R24665. XX DR EMBL: X05328; SCARGIII. DR UniProtKB: P07250; ARG3_YEAST. XX RN [1]; RE0001716. RX PUBMED: 8455631. RA Messenguy F., Dubois E. RT Genetic evidence for a role for MCM1 in the regulation of arginine metabolism in Saccharomyces cerevisiae RL Mol. Cell. Biol. 13:2586-2592 (1993). RN [2]; RE0015783. RX PUBMED: 1944291. RA Vidal M., Gaber R. F. RT RPD3 encodes a second factor required to achieve maximum positive and negative transcriptional states in Saccharomyces cerevisiae RL Mol. Cell. Biol. 11:6317-6327 (1991). RN [3]; RE0015874. RX PUBMED: 10632874. RA El Bakkoury M., Dubois E., Messenguy F. RT Recruitment of the yeast MADS-box proteins, ArgRI and Mcm1 by the pleiotropic factor ArgRIII is required for their stability. RL Mol. Microbiol. 35:15-31 (2000). XX //