AC T00500
XX
ID T00500
XX
DT 15.10.1992 (created); ewi.
DT 29.11.2012 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Mcm1p
XX
SY FUN80; GRM; MCM1; MCM1p; PRTF; YMR043W.
XX
OS yeast, Saccharomyces cerevisiae
OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
GE G004171 MCM1.
XX
CL C0014; MADS; F4.4.1.3.1.
XX
SZ 286 AA; 32.8 kDa (gene) (calc.).
XX
SQ MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
SQ LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
SQ MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
SQ QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
SQ QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY
XX
SC Swiss-Prot#P11746
XX
FT 16 75 
SM00432; MADS.
FT 16 76 
PS50066; MADS_BOX_2.
FT 24 74 
PF00319; SRF-type transcription factor (DNA-binding a.
FT 98 120 
acidic region (21/23), required for alpha-specific gene activation [17].
FT 121 285 
glutamine-rich region (71/165), trans-activation domain [17].
XX
SF dimeric binding to sequence elements with dyad symmetry [10];
SF DNA-binding modulated by MATalpha1 and MATalpha2 [2] [17] [10];
SF Mcm1p sets spacing and orientation of the homeo domains of two alpha2 molecules on the DNA such that Mcm1p contacts the central 11bp, alpha2 the 10 flanking base pairs at both sides [6] [2] [10];
SF the DNA-binding MADS box is sufficient for repressing a-specific genes and for replication initiation [15] [17];
SF by direct interaction through AA 73, 75, 77 and 78, Mcm1p forms a ternary complex with STE12 that represses the a-specific STE2 gene [5];
SF Glu-17 is important to define DNA sequence specificity compared with vertebrate MEF-2 and SRF [20];
SF different alanine residues in the MADS box are essential for viability and transcriptional regulation, respectively [22];
SF DNA bending of the QPPAL binding site [24];
XX
FF activator by its own or, for alpha-specific genes, in cooperation with MATalpha1 [1] [17] [12] [10];
FF repressor of a-specific genes in cooperation with MATalpha2 [3] [17] [12] [10];
FF activator of replication of DNA [17];
FF presumably regulates genes involved in cell cycle control, in synthesis of cell wall/membrane structures, cell metabolism, and an heat-shock-inducible secreted glycoprotein [19];
FF interacts with Arg80p T00043 and is stabilized by Arg82p T01259 [21];
FF ArgRp/Mcm1p complex represses ARG1 transcription by way of repressing the E2 ubiquitin conjugase Rad6p [23];
XX
IN T01099 alpha-1; maize, Zea mays.
IN T00043 Arg80p; yeast, Saccharomyces cerevisiae.
IN T00044 Arg81p; yeast, Saccharomyces cerevisiae.
IN T01259 Arg82p; yeast, Saccharomyces cerevisiae.
IN T00050 atf1; fission yeast, Schizosaccharomyces pombe.
IN T00486 Matalpha1p; yeast, Saccharomyces cerevisiae.
IN T00487 Matalpha2p; yeast, Saccharomyces cerevisiae.
IN T01289 STE12; yeast, Kluyveromyces lactis.
IN T00772 Ste12p; yeast, Saccharomyces cerevisiae.
IN T00801 TCF; human, Homo sapiens.
IN T01399 TCF; mouse, Mus musculus.
IN T04357 Yhp1p; yeast, Saccharomyces cerevisiae.
IN T13934 Yox1p; yeast, Saccharomyces cerevisiae.
XX
MX M00125 F$MCM1_01.
MX M01051 F$MCM1_02.
MX M01510 F$MCM1_03.
MX M01831 F$MCM1_Q6.
XX
BS R03821.
BS R03822.
BS R06858.
BS R06859.
BS R06860.
BS R06861.
BS R06862.
BS R06863.
BS R06864.
BS R06865.
BS R06866.
BS R06867.
BS R06868.
BS R06869.
BS R06870.
BS R06871.
BS R06872.
BS R06873.
BS R06874.
BS R06875.
BS R06876.
BS R06877.
BS R06878.
BS R06879.
BS R06880.
BS R29547.
BS R29811.
BS R33829.
BS R33861.
BS R03608.
BS R00466.
BS R01889.
BS R04807.
BS R00474.
BS R03057.
BS R24646.
BS R01902.
BS R12747.
BS R12745.
BS R12746.
BS R12743.
BS R12744.
BS R12749.
BS R12751.
BS R12752.
BS R22974.
BS R29535.
BS R33403.
BS R12740.
BS R12742.
BS R23024.
BS R22956.
BS R01045.
BS R01046.
BS R01047.
BS R01901.
BS R01048.
BS R24647.
BS R01363.
BS R01364.
BS R01891.
BS R01900.
BS R01365.
BS R24645.
BS R27987.
BS R12739.
BS R23032.
BS R12748.
BS R01476.
BS R01477.
XX
DR EMBL: M17511; SCFUN80.
DR EMBL: X14187; SCMCM1.
DR UniProtKB: P11746; MCM1_YEAST.
XX
RN [1]; RE0000108.
RX PUBMED: 3304657.
RA Bender A., Sprague jr G. F.
RT MATalpha1 protein, a yeast transcription activator, binds synergistically with a second protein to a set of cell-type-specific genes
RL Cell 50:681-691 (1987).
RN [2]; RE0000119.
RX PUBMED: 3289753.
RA Keleher C. A., Goutte C., Johnson A. D.
RT The Yeast Cell-Type-Specific Repressor alpha2 Acts Cooperatively with a Non-Cell-Type-Specific Protein
RL Cell 53:927-936 (1988).
RN [3]; RE0000120.
RX PUBMED: 3893743.
RA Johnson A. D., Herskowitz I.
RT A repressor (MATalpha2 product) and its operator control expression of a set of cell type specific genes in yeast
RL Cell 42:237-247 (1985).
RN [4]; RE0000208.
RX PUBMED: 1732062.
RA Smith D. L., Johnson A. D.
RT A molecular mechanism for combinatorial control in yeast: MCM1 protein sets the spacing and orientation of the homeodomains of an alpha2 dimer
RL Cell 68:133-142 (1992).
RN [5]; RE0000532.
RX PUBMED: 1756729.
RA Mueller C. G. F., Nordheim A.
RT A protein domain conserved between yeast MCM1 and human SRF directs ternary complex formation
RL EMBO J. 10:4219-4229 (1991).
RN [6]; RE0000544.
RX PUBMED: 7910796.
RA Smith D. L., Johnson A. D.
RT Operator-constitutive mutations in a DNA sequence recognized by a yeast homeodomain
RL EMBO J. 13:2378-2387 (1994).
RN [7]; RE0000612.
RX PUBMED: 2159934.
RA Ammerer G.
RT Identification, purification and cloning of a polypeptide (PRTF/GRM) that binds to mating-specific promoter elements in yeast
RL Genes Dev. 4:299-312 (1990).
RN [8]; RE0000639.
RX PUBMED: 3071491.
RA Hayes T. E., Sengupta P., Cochran B. H.
RT The human c-fos serum response factor and the yeast factors GRM/PRTF have related DNA-binding specificities
RL Genes Dev. 2:1713-1722 (1988).
RN [9]; RE0000643.
RX PUBMED: 2550323.
RA Jarvis E. E., Clarc K. L., Sprague jr G. F.
RT The yeast transcription activator PRTF, a homolog of the mammalian serum response factor, is encoded by the MCM1 gene
RL Genes Dev. 3:936-945 (1989).
RN [10]; RE0000644.
RX PUBMED: 2673922.
RA Passmore S., Elble R., Tye B.-K.
RT A protein involved in minichromosome maintenance in yeast binds a transcriptional enhancer conserved in eukaryotes
RL Genes Dev. 3:921-935 (1989).
RN [11]; RE0001345.
RX PUBMED: 2854195.
RA Company M., Errede B.
RT A Ty1 Cell-Type-Specific Regulatory Sequence Is a Recognition Element for a Constitutive Binding Factor
RL Mol. Cell. Biol. 8:5299-5309 (1988).
RN [12]; RE0001406.
RX PUBMED: 2689875.
RA Keleher C. A., Passmore S., Johnson A. D.
RT Yeast Repressor alpha2 Binds to Its Operator Cooperatively with Yeast Protein Mcm1
RL Mol. Cell. Biol. 9:5228-5230 (1989).
RN [13]; RE0001618.
RX PUBMED: 2005902.
RA Dubois E., Messenguy F.
RT In vitro studies of the binding of the ARGR proteins to the ARG5,6 promoter
RL Mol. Cell. Biol. 11:2162-2168 (1991).
RN [14]; RE0001867.
RX PUBMED: 1722028.
RA Hipskind R. A., Rao V. N., Mueller C. G. F., Reddy E. S. P., Nordheim A.
RT Ets-related protein Elk-1 is homologous to the c-fos regulatory factor p62TCF
RL Nature 354:531-534 (1991).
RN [15]; RE0002875.
RX PUBMED: 1756728.
RA Primig M., Winkler H., Ammerer G.
RT The DNA binding and oligomerization domain of MCM1 is sufficient for its interaction with other regulatory proteins
RL EMBO J. 10:4209-4218 (1991).
RN [16]; RE0004108.
RX PUBMED: 3311883.
RA Dubois E., Bercy J., Descamps F., Messenguy F.
RT Characterization of two new genes essential for vegetative growth in Saccharomyces cerevisiae: Nucleotide sequence determination and chromosome mapping
RL Gene 55:265-275 (1987).
RN [17]; RE0004110.
RX PUBMED: 1851120.
RA Christ C., Tye B.-K.
RT Functional domains of the yeast transcription/replication factor MCM1
RL Genes Dev. 5:751-763 (1991).
RN [18]; RE0004111.
RX PUBMED: 3066908.
RA Passmore S., Maine G. T., Elble R., Christ C., Tye B. K.
RT Saccharomyces cerevisiae protein involved in plasmid maintenance is necessary for mating of MAT alpha cells
RL J. Mol. Biol. 204:593-606 (1988).
RN [19]; RE0004113.
RX PUBMED: 8264602.
RA Kuo M.-H., Grayhack E.
RT A library of yeast genomic MCM1 binding sites contains gene involved in cell cycle control, cell wall and membrane structure, and metabolism
RL Mol. Cell. Biol. 14:348-359 (1994).
RN [20]; RE0004114.
RX PUBMED: 7623803.
RA Nurrish S. J., Treisman R.
RT DNA binding specificity determinants in MADS-box transcription factors
RL Mol. Cell. Biol. 15:4076-4085 (1995).
RN [21]; RE0015874.
RX PUBMED: 10632874.
RA El Bakkoury M., Dubois E., Messenguy F.
RT Recruitment of the yeast MADS-box proteins, ArgRI and Mcm1 by the pleiotropic factor ArgRIII is required for their stability.
RL Mol. Microbiol. 35:15-31 (2000).
RN [22]; RE0017876.
RX PUBMED: 12052870.
RA Mead J., Bruning A. R., Gill M. K., Steiner A. M., Acton T. B., Vershon A. K.
RT Interactions of the Mcm1 MADS Box Protein with Cofactors That Regulate Mating in Yeast.
RL Mol. Cell. Biol. 22:4607-4621 (2002).
RN [23]; RE0018182.
RX PUBMED: 12024015.
RA Turner S. D., Ricci A. R., Petropoulos H., Genereaux J., Skerjanc I. S., Brandl C. J.
RT The E2 ubiquitin conjugase Rad6 is required for the ArgR/Mcm1 repression of ARG1 transcription.
RL Mol. Cell. Biol. 22:4011-4019 (2002).
RN [24]; RE0022791.
RX PUBMED: 10064699.
RA West A. G., Sharrocks A. D.
RT MADS-box transcription factors adopt alternative mechanisms for bending DNA.
RL J. Mol. Biol. 286:1311-1323 (1999).
XX
//