TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04357 XX ID T04357 XX DT 26.02.2001 (created); hom. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Yhp1p XX SY YHP1; YHP1p. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004440 YHP1. XX HO YOX1 (S. cerevisiae). XX CL C0006; homeo. XX SZ 353 AA; 39.6 kDa (cDNA) (calc.). XX SQ MESRNTVLPSLPNIITGTSNSPFQLHTLPNTNFPSDDQGDIRLPPLAASAHIVRPVVNIY SQ KSPCDEERPKRKSPQAVDFLSQRVTTSMTPLSKPKKLSSHSPFTPTVRVCSKEQPPQSMH SQ SYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRT SQ SSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHC SQ KVHSNDSMSMISYSDAALEITSTPTSTKEAITAELLKTSPANTSSIFEDHHITPCKPGGQ SQ LKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFNAYERKPLGEVDLNSFKN XX SC Translated from EMBL #U33007 XX FT 171 231 PS50071; HOMEOBOX_2. FT 173 235 SM00389; HOX_1. FT 174 230 PF00046; Homeobox domain. XX SF UAS of the Yhp1p promoter contains an MCE that is target of Mcm1p T00500 and is also an activation site of Sln1p [2]; XX CP diploid a/alpha cells under sporulation conditions. XX FF Yhp1p is involved in the transduction of the starvation signal which leads to meiosis in diploid a/alpha cells [1]; FF represses IME1 T01068 under nutrient conditions by directly binding to a 28bp URS [1]; XX IN T00500 Mcm1p; yeast, Saccharomyces cerevisiae. XX MX M01668 F$YHP1_01. XX BS R09883. BS R22955. XX DR EMBL: U33007; DR UniProtKB: Q04116; XX RN [1]; RE0015809. RX PUBMED: 10705372. RA Kunoh T., Kaneko Y., Harashima S. RT YHP1 encodes a new homeoprotein that binds to the IME1 promoter in Saccharomyces cerevisiae RL Yeast 16:439-449 (2000). RN [2]; RE0015811. RX PUBMED: 11097841. RA Kunoh T., Kaneko Y., Harashima S. RT Positive regulation of transcription of homeoprotein-encoding YHP1 by the two-component regulator sln1 in Saccharomyces cerevisiae RL Biochem. Biophys. Res. Commun. 278:344-348 (2000). XX //