TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00486 XX ID T00486 XX DT 15.10.1992 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Matalpha1p XX SY alpha1; MATalpha1; MATalpha1p. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G000947 MATALPHA1. XX CL C0006; homeo; F3.1.1.0.4. XX SZ 175 AA; 20.4 kDa (gene) (calc.). XX SQ MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF SQ LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA SQ EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL XX SC Swiss-Prot#P0CY06 XX FT 1 175 PF04769; Mating-type protein MAT alpha. XX SF binds cooperatively with MCM1 to PQ elements of alpha-specific genes [3]; XX FF activator [3]; FF alpha1+MCM1 activate alpha-specific genes; FF responds to a-mating pheromone [3]; FF STE12 interaction is species-specific (no interaction with K. lactis STE12); FF transcription of the alpha 1 gene requires STE5 which itself is under a1/alpha2 repression [8]; XX IN T00500 Mcm1p; yeast, Saccharomyces cerevisiae. IN T00772 Ste12p; yeast, Saccharomyces cerevisiae. XX BS R09080. BS R36141. BS R01047. BS R01048. BS R01364. XX DR EMBL: L00060; DR EMBL: V01313; DR EMBL: V01315; DR EMBL: X59720; DR UniProtKB: P0CY06; XX RN [1]; RE0000108. RX PUBMED: 3304657. RA Bender A., Sprague jr G. F. RT MATalpha1 protein, a yeast transcription activator, binds synergistically with a second protein to a set of cell-type-specific genes RL Cell 50:681-691 (1987). RN [2]; RE0000644. RX PUBMED: 2673922. RA Passmore S., Elble R., Tye B.-K. RT A protein involved in minichromosome maintenance in yeast binds a transcriptional enhancer conserved in eukaryotes RL Genes Dev. 3:921-935 (1989). RN [3]; RE0000724. RX PUBMED: 1916267. RA Sengupta P., Cochran B. H. RT MATalpha1 can mediate gene activation by a-mating factor RL Genes Dev. 5:1924-1934 (1991). RN [4]; RE0000784. RX PUBMED: 8339934. RA Yuan Y.-l., Stroke H. L., Fields S. RT Coupling of cell identity to signal response in yeast: interaction between the alpha1 and STE12 proteins RL Genes Dev. 7:1584-1597 (1993). RN [5]; RE0002875. RX PUBMED: 1756728. RA Primig M., Winkler H., Ammerer G. RT The DNA binding and oligomerization domain of MCM1 is sufficient for its interaction with other regulatory proteins RL EMBO J. 10:4209-4218 (1991). RN [6]; RE0005133. RX PUBMED: 7034964. RA Astell C. R., Ahlstrom-Jonasson L., Smith M. RT The sequence of the DNAs coding for the mating-type loci of saccharomyces cerevisiae RL Cell 27:15-23 (1981). RN [7]; RE0005134. RX PUBMED: 6256656. RA Nasmyth K. A., Tatchell K., Hall B. D., Astell C., Smith M. RT A position effect in the control of transcription at yeast mating type loci RL Nature 289:244-250 (1981). RN [8]; RE0005135. RX PUBMED: 8455598. RA Mukai Y., Harashima S., Oshima Y. RT Function of the Ste signal transduction pathway for mating pheromones sustains MATalpha1 transcription in Saccharomyces cerevisiae RL Mol. Cell. Biol. 13:2050-2060 (1993). RN [9]; RE0005136. RX PUBMED: 1789011. RA Jacquet M., Buhler J.-M., Iborra F., Francingues-Gaillard M.-C., Soustelle C. RT The MAT locus revisited within a 9.8 kb fragment of chromosome III containing BUD5 and two new open reading frames RL Yeast 7:881-888 (1991). RN [10]; RE0005137. RX PUBMED: 6276023. RA Tatchell K., Nasmyth K. A., Hall B. D., Astell C. R., Smith M. RT The sequence of the DNAs coding for the mating-type loci of Saccharomyces cerevisiae. RL Cell 27:25-35 (1981). XX //