TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01420 XX ID T01420 XX DT 03.04.1995 (created); ewi. DT 11.12.2013 (updated); mkl. CO Copyright (C), QIAGEN. XX FA C/EBPbeta-LIP XX SY C/EBPbeta(p20); C/EBPbeta3; LIP; liver-enriched inhibitory protein; p20(C/EBPbeta); p20C/EBPbeta. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G013627 Cebpb. XX CL C0008; bZIP. XX SZ 145 AA; 15.6 kDa (cDNA) (calc.), 20 kDa (SDS) XX SQ MAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAK SQ AKAKKAVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQL SQ SRELSTLRNLFKQLPEPLLASAGHC XX FT 69 133 SM00338; brlzneu. FT 70 123 PF07716; Basic region leucine zipper. FT 71 134 PS50217; BZIP. XX SF lacks the N-terminal transactivation domain in comparison with p35 isoform T00459, shares the C-terminal DBD and dimerization domains; SF generated from the same mRNA as LAP (C/EBPbeta) by a leaky scanning mechanism; SF pI 10.61 (calc.) [1]; SF half-saturation of DNA-binding at 0.44 nM, thus lower than for C/EBPbeta [1]; SF C-terminal region is sufficient to mediate interactions with A-box of Elk-1 [4]; XX CP enriched in liver cells [1]; low in liver, high levels in fibroblasts, lymphocytes [3] [1] [3]. XX FF transcriptional repressor; FF attenuates transcriptional stimulation by C/EBPbeta, probably due to its higher DNA-binding affinity [1]; FF cellular ratio of C/EBPbeta / LIP is essential for activation; FF increases 5-fold during liver differentiation [1]; FF in contrast to full-length C/EBPbeta, it does not arrest hepatoma cell cycle progression and even antagonizes C/EBPbeta in doing so [2]; FF enrichment in fibroblasts over the longer C/EBPbeta isoforms is (partially) due to an extended-half-life [3]; XX IN T00459 C/EBPbeta-FL; rat, Rattus norvegicus. IN T02105 C/EBPbeta-LAP; rat, Rattus norvegicus. IN T00250 Elk-1; human, Homo sapiens. XX MX M00109 V$CEBPB_01. MX M00117 V$CEBPB_02. MX M07315 V$CEBPB_Q3. MX M01896 V$CEBPB_Q6. MX M00912 V$CEBP_Q2_01. MX M00770 V$CEBP_Q3. XX BS R24131. BS R00089. BS R58214. BS R58215. BS R58216. BS R58217. BS R58218. BS R58222. BS R58225. BS R58226. BS R58228. BS R58229. BS R58230. BS R58231. BS R58237. BS R28689. BS R01344. XX DR TRANSPATH: MO000025659. XX RN [1]; RE0002865. RX PUBMED: 1934061. RA Descombes P., Schibler U. RT A liver-enriched transcriptional activator protein, LAP, and a transcriptional inhibitory protein, LIP, are translated from the same mRNA RL Cell 67:569-579 (1991). RN [2]; RE0007044. RX PUBMED: 7906646. RA Buck M., Turler H., Chojkier M. RT LAP (NF-IL-6), a tissue-specific transcriptional activator, is an inhibitor of hepatoma cell proliferation RL EMBO J. 13:851-860 (1994). RN [3]; RE0007055. RX PUBMED: 8007984. RA Sears R. C., Sealy L. RT Multiple forms of C/EBP beta bind the EFII enhancer sequence in the Rous sarcoma virus long terminal repeat RL Mol. Cell. Biol. 14:4855-4871 (1994). RN [4]; RE0016725. RX PUBMED: 11151091. RA Hanlon M., Bundy L. M., Sealy L. RT C/EBPBeta and Elk-1 synergistically transactivate the c-fos serum response element. RL BMC Cell Biol. 1:2 (2000). XX //