AC T00594
XX
ID T00594
XX
DT 15.10.1992 (created); ewi.
DT 21.10.2014 (updated); pos.
CO Copyright (C), QIAGEN.
XX
FA RelA-p65-isoform1
XX
SY NF-kappaB (p65); NFKB3; Nuclear Factor kappa B p65; Nuclear factor NF-kappa-B p65 subunit; p65; Rel-A; RelA; Transcription factor p65.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004622 RELA; HGNC: RELA.
XX
CL C0020; Rel; 6.1.1.2.1.1.
XX
SZ 551 AA; 60.2 kDa (cDNA) (calc.), 65 kDa (SDS)
XX
SQ MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
SQ IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
SQ VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLP
SQ HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
SQ QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
SQ KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
SQ DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
SQ VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
SQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
SQ DFSALLSQISS
XX
SC translated from EMBL:M62399
XX
FT 16 190 
PS50254; REL_2.
FT 21 186 
PF00554; Rel homology domain (RHD).
FT 193 289 
SM00429; iptmega2.
FT 194 289 
PF01833; IPT/TIG domain.
FT 216 216 
cysteine important for homodimerization [20].
FT 273 276 
potential PKA site important for homodimerization [20].
FT 286 551 
binding to CBP/p300 [33].
FT 301 304 
nuclear localization signal [24].
FT 415 550 
transcription activation domain [11].
FT 428 521 
trans-activation domain 2 (TA2) [12].
FT 458 483 trans-activation domain 1' (TA1') [12].
FT 521 551 trans-activation domain 1 (TA1) [12].
XX
SF four AA residues in the DNA-binding Rel domain mediate a distinct DNA-binding specificity of the RelA-p65-isoform1-p65 (p65) homodimer compared to heterodimers [21];
SF cytoplasmic inhibitors (IkappaB-alpha and -beta) bind to the Rel domain of RelA-p65-isoform1-p65 thus masking the nuclear localization signal [13] [24] [7] [5];
SF the splice variant p65delta cannot dimerize with itself or with p50, but with intact RelA-p65-isoform1-p65, and interacts only weakly with IkappaB-alpha since dimerization is important for inhibitor binding [11] [24];
SF the Rel domain of RelA-p65-isoform1-p65 interacts with leucine zipper structures of c-Fos, c-Jun, C/EBP-beta, and probably also ATF-a and CRE-BP1 [17] [18] [31];
SF it may also interact with the zinc finger domain of Sp1 and the DNA-binding domain of the estrogen receptor (ER), independent of its ligand-bound status [15] [28];
SF the potent trans-activating domain comprises several subdomains, of which TA2 contains another TA1-homologous region, both revealing a highly amphiphilic character when alpha-helically folded, with one side exclusively comprising serine residues [12];
SF moreover, the trans-activating domain contains several acidic modules with a critical core phenylalanine and flanking bulky hydrophobic residues [12];
XX
CP ubiquitous.
XX
FF activator;
FF contributes the major transcription activation domain to the NF-kappaB T00590 complex [4];
FF at some sequences, its homodimers may act as transcriptional activators [9] [3];
FF synergistic effects with AP-1 through AP-1 sites as well as through kappaB sites (c-Fos and c-Jun, not JunB or JunD, also not found for NF-kappaB1) [31];
FF synergism with C/EBP family members and with Sp1, e. g. at the HIV-1 LTR [35] [18] [32];
FF in T cells, RelA-p65-isoform1-p65 is phosphorylated by a 43 kDa protein kinase associated with the NF-kappaB/IkappaB complex [14];
FF subsequent release of RelA-p65-isoform1-p65 permits nuclear translocation [16];
FF PKC-mediated phosphorylation and trans-activation through TA2 [12];
FF constitutive phosphorylation of TA1 [12];
FF PKA-mediated phosphorylation decreases nuclear translocation of RelA-p65-isoform1-p65, presumably by decreasing the rate of IkappaB degradation [23];
FF the splice variant p65delta suppresses NF-kappaB activity and exhibits transforming properties [26];
XX
IN T01795 AhR; human, Homo sapiens.
IN T00167 ATF-2-isoform1; human, Homo sapiens.
IN T00052 ATFa-isoform6; human, Homo sapiens.
IN T00123 c-Fos; human, Homo sapiens.
IN T00133 c-Jun; human, Homo sapiens.
IN T00168 c-Rel; human, Homo sapiens.
IN T00581 C/EBPbeta; human, Homo sapiens.
IN T02214 CBP-isoform1; human, Homo sapiens.
IN T18378 CBP; human, Homo sapiens.
IN T00176 CTF-1; human, Homo sapiens.
IN T06570 Dnmt1; human, Homo sapiens.
IN T27826 Dnmt1; mouse, Mus musculus.
IN T08705 Egr-4; human, Homo sapiens.
IN T00261 ER-alpha; human, Homo sapiens.
IN T17961 Gfi1; Mammalia.
IN T05076 GR; human, Homo sapiens.
IN T00950 IkappaB-alpha; human, Homo sapiens.
IN T18455 IkappaB-alpha; Mammalia.
IN T00414 IkappaB-beta; human, Homo sapiens.
IN T00416 IkappaB-beta; chick, Gallus gallus.
IN T00971 IkappaB-beta; mouse, Mus musculus.
IN T17890 ing4-isoform1; human, Homo sapiens.
IN T17025 ing4; human, Homo sapiens.
IN T08251 LRF; human, Homo sapiens.
IN T00593 NF-kappaB1-p50; human, Homo sapiens.
IN T17520 NF-kappaB1; Mammalia.
IN T01927 NF-kappaB2-p100; human, Homo sapiens.
IN T01930 NF-kappaB2-p49; human, Homo sapiens.
IN T00394 NF-kappaB2-p52; human, Homo sapiens.
IN T01929 p100; chick, Gallus gallus.
IN T23075 p100; Mammalia.
IN T09322 p160MBP-isoform1; human, Homo sapiens.
IN T01427 p300; human, Homo sapiens.
IN T23091 p300; Mammalia.
IN T01523 RelA-p65-delta; human, Homo sapiens.
IN T00594 RelA-p65-isoform1; human, Homo sapiens.
IN T22169 RTA; KSHV, Kaposi's sarcoma-associated herpesvirus (Human herpesvirus 8).
IN T08433 RXR-alpha; human, Homo sapiens.
IN T17974 TAFII105; human, Homo sapiens.
IN T00897 v-Rel; REV-T, reticuloendotheliosis virus (strain T).
XX
MX M00052 V$NFKAPPAB65_01.
MX M00054 V$NFKAPPAB_01.
MX M00774 V$NFKB_Q6_01.
MX M03563 V$RELA_Q6.
XX
BS R02921.
BS R14659.
BS R32490.
BS R14640.
BS R14431.
BS R14460.
BS R08088.
BS R00923.
BS R13472.
BS R13473.
BS R13474.
BS R14486.
BS R00943.
BS R01634.
BS R02909.
BS R30143.
BS R38274.
BS R22655.
BS R22555.
BS R22558.
BS R14438.
BS R32007.
BS R32013.
BS R32008.
BS R32009.
BS R32010.
BS R32012.
BS R17059.
BS R17060.
BS R17061.
BS R17062.
BS R17063.
BS R11382.
BS R16684.
BS R22506.
BS R22617.
BS R17119.
BS R17121.
BS R73911.
BS R20680.
BS R22635.
BS R22543.
BS R14565.
BS R13476.
BS R13477.
BS R36035.
BS R30535.
BS R74083.
BS R00879.
BS R01744.
BS R01058.
BS R01065.
BS R22553.
BS R08104.
BS R04703.
BS R13306.
BS R14448.
BS R14449.
BS R04905.
XX
DR TRANSPATH: MO000019363.
DR TRANSCOMPEL: C00098.
DR TRANSCOMPEL: C00100.
DR TRANSCOMPEL: C00101.
DR TRANSCOMPEL: C00148.
DR TRANSCOMPEL: C00155.
DR TRANSCOMPEL: C00338.
DR TRANSCOMPEL: C00340.
DR TRANSCOMPEL: C00343.
DR TRANSCOMPEL: C00348.
DR TRANSCOMPEL: C00406.
DR TRANSCOMPEL: C00414.
DR EMBL: L01459; HSNFKBX.
DR EMBL: L19067;
DR EMBL: M62399;
DR EMBL: Z22948;
DR EMBL: Z22949; HSP65B.
DR EMBL: Z22950; HSP65C.
DR EMBL: Z22951; HSP65D.
DR EMBL: Z22952; HSP65E.
DR EMBL: Z22953; HSP65F.
DR EMBL: Z22954; HSP65G.
DR UniProtKB: Q04206-1;
XX
RN [1]; RE0000091.
RX PUBMED: 2184941.
RA Zabel U., Bauerle P. A.
RT Purified human IkappaB can rapidly dissociate the complex of the NF-kappaB transcription factor with its cognate DNA
RL Cell 61:255-265 (1990).
RN [2]; RE0000285.
RX PUBMED: 3076097.
RA Baeuerle P. A., Lenardo M., Pierce J. W., Baltimore D.
RT Phorbol-ester-induced activation of the NF-kappaB transcription factor involves dissociation of an apparently cytoplasmic NF-kappaB/inhibitor complex
RL Cold Spring Harb. Symp. Quant. Biol. 53:789-798 (1988).
RN [3]; RE0000458.
RX PUBMED: 2050119.
RA Urban M. B., Schreck R., Baeuerle P. A.
RT NF-kappaB contacts DNA by a heterodimer of the p50 and p65 subunit
RL EMBO J. 10:1817-1825 (1991).
RN [4]; RE0000506.
RX PUBMED: 1935902.
RA Schmitz M. L., Baeuerle P. A.
RT The p65 subunit is responsible for the strong transcription activating potential of NF-kappaB
RL EMBO J. 10:3805-3817 (1991).
RN [5]; RE0000609.
RX PUBMED: 2691328.
RA Baeuerle P., Baltimore D.
RT A 65-kD subunit of active NF-kappaB is required for inhibition of NF-kappaB by IkappaB
RL Genes Dev. 3:1689-1698 (1989).
RN [6]; RE0000629.
RX PUBMED: 2558054.
RA Errede B., Ammerer G.
RT STE12, a protein involved in cell-type-specific transcription and signal transduction in yeast, is part of protein-DNA complexes
RL Genes Dev. 3:1349-1361 (1989).
RN [7]; RE0000726.
RX PUBMED: 2125960.
RA Urban M. B., Baeuerle P. A.
RT The 65-kD subunit of NF-kappaB is a receptor for IkappaB and a modulator of DNA-binding specificity
RL Genes Dev. 4:1975-1984 (1990).
RN [8]; RE0001632.
RX PUBMED: 2548081.
RA Shirakawa F., Mizel S. B.
RT In vitro activation and nuclear translocation of NF-kappaB catalyzed by cyclic AMP-dependent protein kinase and protein kinase C
RL Mol. Cell. Biol. 9:2424-2430 (1991).
RN [9]; RE0002682.
RX PUBMED: 2006423.
RA Ruben S. M., Dillon P. J., Schreck R., Henkel T., Chen C.-H., Maher M., Baeuerle P. A., Rosen C. A.
RT Isolation of a rel-related human cDNA that potentially encodes the p65-kD subunit of NF-kappaB
RL Science 251:1490-1493 (1991).
RN [10]; RE0002922.
RX PUBMED: 1406630.
RA Kunsch C., Ruben S. M., Rosen C. A.
RT Selection of optimal kappaB/Rel DNA-binding motifs: interaction of both subunits of NF-kappaB with DNA is required for transcriptional activation
RL Mol. Cell. Biol. 12:4412-4421 (1992).
RN [11]; RE0003105.
RX PUBMED: 1732726.
RA Ruben S. M., Narayanan R., Klement J. F., Chen C.-H., Rosen C. A.
RT Functional characterization of the NF-kappaB p65 transcriptional activator and an alternatively spliced derivate
RL Mol. Cell. Biol. 12:444-454 (1992).
RN [12]; RE0003823.
RX PUBMED: 7797554.
RA Schmitz M. L., dos Santos Silva M. A., Baeuerle P. A.
RT Transactivation domain 2 (TA2) of p65 NF-kappaB
RL J. Biol. Chem. 270:15576-15584 (1995).
RN [13]; RE0004487.
RX PUBMED: 7679069.
RA Zabel U., Henkel T., dos Santos Silva M., Baeuerle P. A.
RT Nuclear uptake control of NF-kappaB by MAD-3, an IkappB protein present in the nucleus
RL EMBO J. 12:201-211 (1993).
RN [14]; RE0004496.
RX PUBMED: 8253816.
RA Hayashi T., Sekine T., Okamoto T.
RT Identification of a new serine kinase that activates NFkappaB by direct phosphorylation
RL J. Biol. Chem. 268:26790-26795 (1993).
RN [15]; RE0004503.
RX PUBMED: 7651415.
RA Stein B., Yang M. X.
RT Repression of the interleukin-6 promoter by estrogen receptor is mediated by NF-kappaB and C/EBPbeta
RL Mol. Cell. Biol. 15:4971-4979 (1995).
RN [16]; RE0004507.
RX PUBMED: 7925300.
RA Naumann M., Scheidereit C.
RT Activation of NF-6B in vivo is regulated by multiple phosphorylations
RL EMBO J. 13:4597-4607 (1994).
RN [17]; RE0004521.
RX PUBMED: 7692236.
RA Kaszubska W., Hooft van Huijsduijnen R., Ghersa P., DeRaemy-Schenk A.-M., Chen B. P. C., Hai T., DeLamarter J. F., Whelan J.
RT Cyclic AMP-independent ATF family members interact with NF-kappaB and function in the activation of the E-selectin promoter in response to cytokines
RL Mol. Cell. Biol. 13:7180-7190 (1993).
RN [18]; RE0004524.
RX PUBMED: 8321203.
RA Stein B., Cogswell P. C., Baldwin jr A. S.
RT Functional and physical associations between NF-kappaB and C/EBP family members: a Rel domain-bZIP interaction
RL Mol. Cell. Biol. 13:3964-3974 (1993).
RN [19]; RE0004541.
RX PUBMED: 8441377.
RA Duckett C. S., Perkins N. D., Kowalik T. F., Schmid R. M., Huang E.-S., Baldwin jr A. S., Nabel G. J.
RT Dimerization of NF-KB2 with RelA(p65) regulates DNA binding, transcriptional activation, and inhibition by an IkappaB-alpha (MAD-3)
RL Mol. Cell. Biol. 13:1315-1322 (1993).
RN [20]; RE0004543.
RX PUBMED: 8246997.
RA Ganchi P. A., Sun S. C., Greene W. C., Ballard D. W.
RT A novel NF-kappaB complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization
RL Mol. Cell. Biol. 13:7826-7835 (1993).
RN [21]; RE0004544.
RX PUBMED: 8321192.
RA Coleman T. A., Kunsch C., Maher M., Ruben S. M., Rosen C. A.
RT Acquisition of NFKB1-selective DNA binding by substitution of four amino acid residues from NFKB1 into RelA
RL Mol. Cell. Biol. 13:3850-3859 (1993).
RN [22]; RE0004546.
RX PUBMED: 7935437.
RA Blair W. S., Bogerd H. P., Madore S. J., Cullen B. R.
RT Mutational analysis of the transcription activation domain of RelA: identification of a highly synergistic minimal acidic activation module
RL Mol. Cell. Biol. 14:7226-7234 (1994).
RN [23]; RE0004548.
RX PUBMED: 7744006.
RA Neumann M., Grieshammer T., Chuvpilo S., Kneitz B., Lohoff M., Schimpl A., Franza jr B. R., Serfling E.
RT ReIA/p65 is a molecular target for the immunosuppressive action of protein kinase A
RL EMBO J. 14:1991-2004 (1995).
RN [24]; RE0004549.
RX PUBMED: 1340770.
RA Beg A. A., Ruben S. M., Scheinman R. I., Rosen C. A., Baldwin jr A. S.
RT IkappaB interacts with the nuclear localization sequences of the subunits of the NF-kappaB: a mechanism for cytoplasmic retention
RL Genes Dev. 6:1899-1913 (1992).
RN [25]; RE0004552.
RX PUBMED: 1644814.
RA Duyao M. P., Kessler D. J., Spicer D. B., Bartholomew C., Cleveland J. L., Siekevitz M., Sonenshein G. E.
RT Transactivation of the c-myc promoter by human T cell leukemia virus type I tax is mediated by NFkappaB
RL J. Biol. Chem. 267:16288-16291 (1992).
RN [26]; RE0004554.
RX PUBMED: 1566083.
RA Narayanan R., Klement J. F., Ruben S. M., Higgins K. A., Rosen C. A.
RT Identification of a naturally occurring transforming variant of the p65 subunit of NF-kappaB
RL Science 256:367-370 (1992).
RN [27]; RE0004556.
RX PUBMED: 8234333.
RA Higgins K. A., Perez J. R., Coleman T. A., Dorshkind K., McComas W. A., Sarmiento U. M., Rosen C. A., Narayanan R.
RT Antisense inhibition of the p65 subunit of NF-kappaB blocks tumorigenicity and causes tumor regression
RL Proc. Natl. Acad. Sci. USA 90:9901-9905 (1993).
RN [28]; RE0004557.
RX PUBMED: 7935378.
RA Perkins N. D., Agranoff A. B., Pascal E., Nabel G. J.
RT An interaction the DNA-binding domains of RelA(p65) and Sp1 mediates human immunodeficiency virus gene activation
RL Mol. Cell. Biol. 14:6570-6583 (1994).
RN [29]; RE0004558.
RX PUBMED: 1542686.
RA Ballard D. W., Dixon E. P., Peffer N. J., Bogerd H., Doerre S., Stein B., Greene W. C.
RT The 65-kDa subunit of human NF-kappaB functions as a potent transcriptional activator and a target for v-Rel-mediated repression
RL Proc. Natl. Acad. Sci. USA 89:1875-1879 (1992).
RN [30]; RE0004559.
RX PUBMED: 1740106.
RA Hansen S. K., Nerlov C., Zabel U., Verde P., Johnsen M., Baeuerle P., Blasi F.
RT A novel complex between the p65 subunit of NF-kappaB and c-Rel binds to a DNA element involved in the phorbol ester induction of the human urokinase gene
RL EMBO J. 11:205-213 (1992).
RN [31]; RE0004732.
RX PUBMED: 8404856.
RA Stein B., Baldwin jr A. S., Ballard D. W., Greene W. C., Angel P., Herrlich P.
RT Cross-coupling of the NF-6B p65 and Fos/Jun transcription factors produces potentiated biological function
RL EMBO J. 12:3879-3891 (1993).
RN [32]; RE0016565.
RX PUBMED: 8253080.
RA Perkins N. D., Edwards N. L., Duckett C. S., Agranoff A. B., Schmid R. M., Nabel G. J.
RT A cooperative interaction between NF-kappaB and Sp1 is required for HIV-1 enhancer activation.
RL EMBO J. 12:3551-3558 (1993).
RN [33]; RE0018223.
RX PUBMED: 9096323.
RA Gerritsen M. E., Williams A. J., Neish A. S., Moore S., Shi Y., Collins T.
RT CREB-binding protein/p300 are transcriptional coactivators of p65.
RL Proc. Natl. Acad. Sci. USA 94:2927-2932 (1997).
RN [34]; RE0018653.
RX PUBMED: 10713156.
RA Read M. A., Brownell J. E., Gladysheva T. B., Hottelet M., Parent L. A., Coggins M. B., Pierce J. W., Podust V. N., Luo. R.-S., Chau V., Palombella V. J.
RT Nedd8 modification of cul-1 activates SCF(beta(TrCP))-dependent ubiquitination of IkappaBalpha
RL Mol. Cell. Biol. 20:2326-2333 (2000).
RN [35]; RE0023683.
RX PUBMED: 14514692.
RA Papin S., Cazeneuve C., Duquesnoy P., Jeru I., Sahali D., Amselem S.
RT The tumor necrosis factor alpha-dependent activation of the human mediterranean fever (MEFV) promoter is mediated by a synergistic interaction between C/EBP beta and NF kappaB p65.
RL J. Biol. Chem. 278:48839-48847 (2003).
RN [36]; RE0030415.
RX PUBMED: 12842894.
RA Sakurai H., Suzuki S., Kawasaki N., Nakano H., Okazaki T., Chino A., Doi T., Saiki I.
RT Tumor necrosis factor-alpha-induced IKK phosphorylation of NF-kappaB p65 on serine 536 is mediated through the TRAF2, TRAF5, and TAK1 signaling pathway.
RL J. Biol. Chem. 278:36916-23 (2003).
RN [37]; RE0035136.
RX PUBMED: 14527995.
RA Martone R., Euskirchen G., Bertone P., Hartman S., Royce T. E., Luscombe N. M., Rinn J. L., Nelson F. K., Miller P., Gerstein M., Weissman S., Snyder M.
RT Distribution of NF-kappaB-binding sites across human chromosome 22.
RL Proc. Natl. Acad. Sci. USA 100:12247-12252 (2003).
RN [38]; RE0035778.
RX PUBMED: 16111893.
RA Chen L. F., Greene W. C.
RT Assessing acetylation of NF-kappaB.
RL Methods 36:368-375 (2005).
RN [39]; RE0040066.
RX PUBMED: 10849440.
RA Yamit-Hezi A., Nir S., Wolstein O., Dikstein R.
RT Interaction of TAFII105 with selected p65/RelA dimers is associated with activation of subset of NF-kappa B genes
RL J. Biol. Chem. 275:18180-7 (2000).
RN [40]; RE0047425.
RX PUBMED: 16014385.
RA Wieland G. D., Nehmann N., Muller D., Eibel H., Siebenlist U., Suhnel J., Zipfel P. F., Skerka C.
RT Early growth response proteins EGR-4 and EGR-3 interact with immune inflammatory mediators NF-kappaB p50 and p65.
RL J. Cell Sci. 118:3203-3212 (2005).
RN [41]; RE0047426.
RX PUBMED: 15677444.
RA Fagerlund R., Kinnunen L., Kohler M., Julkunen I., Melen K.
RT NF-{kappa}B is transported into the nucleus by importin {alpha}3 and importin {alpha}4.
RL J. Biol. Chem. 280:15942-15951 (2005).
RN [42]; RE0047618.
RX PUBMED: 15917220.
RA Lee D. K., Kang J. E., Park H. J., Kim M. H., Yim T. H., Kim J. M., Heo M. K., Kim K. Y., Kwon H. J., Hur M. W.
RT FBI-1 enhances transcription of the nuclear factor-kappaB (NF-kappaB)-responsive E-selectin gene by nuclear localization of the p65 subunit of NF-kappaB.
RL J. Biol. Chem. 280:27783-27791 (2005).
RN [43]; RE0047668.
RX PUBMED: 15465828.
RA Buss H., Dorrie A., Schmitz M. L., Frank R., Livingstone M., Resch K., Kracht M.
RT Phosphorylation of serine 468 by GSK-3beta negatively regulates basal p65 NF-kappaB activity.
RL J. Biol. Chem. 279:49571-49574 (2004).
RN [44]; RE0047688.
RX PUBMED: 10075655.
RA Na S. Y., Kang B. Y., Chung S. W., Han S. J., Ma X., Trinchieri G., Im S. Y., Lee J. W., Kim T. S.
RT Retinoids inhibit interleukin-12 production in macrophages through physical associations of retinoid X receptor and NFkappaB.
RL J. Biol. Chem. 274:7674-7680 (1999).
RN [45]; RE0048131.
RX PUBMED: 7823959.
RA Scheinman R. I., Gualberto A., Jewell C. M., Cidlowski J. A., Baldwin AS J. r.
RT Characterization of mechanisms involved in transrepression of NF-kappa B by activated glucocorticoid receptors.
RL Mol. Cell. Biol. 15:943-953 (1995).
RN [46]; RE0050028.
RX PUBMED: 14690596.
RA Ryo A., Suizu F., Yoshida Y., Perrem K., Liou Y. C., Wulf G., Rottapel R., Yamaoka S., Lu K. P.
RT Regulation of NF-kappaB signaling by Pin1-dependent prolyl isomerization and ubiquitin-mediated proteolysis of p65/RelA.
RL Mol. Cell 12:1413-1426 (2003).
RN [47]; RE0051641.
RX PUBMED: 15208311.
RA Hu W. H., Mo X. M., Walters W. M., Brambilla R., Bethea J. R.
RT TNAP, a novel repressor of NF-kappaB-inducing kinase, suppresses NF-kappaB activation.
RL J. Biol. Chem. 279:35975-35983 (2004).
RN [48]; RE0051660.
RX PUBMED: 16046471.
RA Schwabe R. F., Sakurai H.
RT IKKbeta phosphorylates p65 at S468 in transactivaton domain 2.
RL FASEB J. 19:1758-1760 (2005).
RN [49]; RE0051716.
RX PUBMED: 12748188.
RA Asamitsu K., Tetsuka T., Kanazawa S., Okamoto T.
RT RING finger protein AO7 supports NF-kappaB-mediated transcription by interacting with the transactivation domain of the p65 subunit.
RL J. Biol. Chem. 278:26879-26887 (2003).
RN [50]; RE0051727.
RX PUBMED: 15140884.
RA Jang H. D., Yoon K., Shin Y. J., Kim J., Lee S. Y.
RT PIAS3 suppresses NF-kappaB-mediated transcription by interacting with the p65/RelA subunit.
RL J. Biol. Chem. 279:24873-24880 (2004).
RN [51]; RE0051862.
RX PUBMED: 17196614.
RA Owen H. R., Elser M., Cheung E., Gersbach M., Kraus W. L., Hottiger M. O.
RT MYBBP1a is a novel repressor of NF-kappaB.
RL J. Mol. Biol. 366:725-736 (2007).
RN [52]; RE0051864.
RX PUBMED: 17000776.
RA Liu Y., Smith P. W., Jones D. R.
RT Breast cancer metastasis suppressor 1 functions as a corepressor by enhancing histone deacetylase 1-mediated deacetylation of RelA/p65 and promoting apoptosis.
RL Mol. Cell. Biol. 26:8683-8696 (2006).
RN [53]; RE0051949.
RX PUBMED: 16382138.
RA Hoberg J. E., Popko A. E., Ramsey C. S., Mayo M. W.
RT IkappaB kinase alpha-mediated derepression of SMRT potentiates acetylation of RelA/p65 by p300.
RL Mol. Cell. Biol. 26:457-471 (2006).
RN [54]; RE0053839.
RX PUBMED: 16407239.
RA Mattioli I., Geng H., Sebald A., Hodel M., Bucher C., Kracht M., Schmitz M. L.
RT Inducible phosphorylation of NF-kappa B p65 at serine 468 by T cell costimulation is mediated by IKK epsilon.
RL J. Biol. Chem. 281:6175-6183 (2006).
RN [55]; RE0054072.
RX PUBMED: 11687592.
RA Solan N. J., Miyoshi H., Carmona E. M., Bren G. D., Paya C. V.
RT RelB cellular regulation and transcriptional activity are regulated by p100.
RL J. Biol. Chem. 277:1405-1418 (2002).
RN [56]; RE0054543.
RX PUBMED: 17317104.
RA Jamaluddin M., Wang S., Boldogh I., Tian B., Brasier A. R.
RT TNF-alpha-induced NF-kappaB/RelA Ser(276) phosphorylation and enhanceosome formation is mediated by an ROS-dependent PKAc pathway.
RL Cell. Signal. 19:1419-1433 (2007).
RN [57]; RE0065182.
RX PUBMED: 19377466.
RA Chew J., Biswas S., Shreeram S., Humaidi M., Wong E. T., Dhillion M. K., Teo H., Hazra A., Fang C. C., Lopez-Collazo E., Bulavin D. V., Tergaonkar V.
RT WIP1 phosphatase is a negative regulator of NF-kappaB signalling.
RL Nat. Cell Biol. 11:659-666 (2009).
RN [58]; RE0071069.
RX PUBMED: 20167866.
RA Lee I. T., Lee C. W., Tung W. H., Wang S. W., Lin C. C., Shu J. C., Yang C. M.
RT Cooperation of TLR2 with MyD88, PI3K, and Rac1 in lipoteichoic acid-induced cPLA2/COX-2-dependent airway inflammatory responses.
RL Am. J. Pathol. 176:1671-1684 (2010).
XX
//