AC T00897
XX
ID T00897
XX
DT 15.10.1992 (created); ewi.
DT 06.05.2013 (updated); msr.
CO Copyright (C), QIAGEN.
XX
FA v-Rel
XX
SY p53(v-rel); v-Rel.
XX
OS REV-T, reticuloendotheliosis virus (strain T)
OC viridae; ss-RNA enveloped viruses; positive strand RNA viruses; retroviridae; oncovirinae; type C oncovirus group; mammalian type C oncoviruses
XX
CL C0020; Rel.
XX
SZ 503 AA; 55.9 kDa (gene) (calc.), 58-60 kDa (SDS)
XX
SQ MDFLTNLRFTEGISEPYIEIFEQPRQRGTRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQI
SQ LNYFGKVKIRTTLVTKNEPYKPHPHDLVGKGCRDGYYEAEFGPERQVLSFQNLGIQCVKK
SQ KDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLIS
SQ NPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVRFVLGNWEAKGSFS
SQ QADVHRQVAIVFRTPPFLGDITEPITVKMQLRRPSDQAVSEPVDFRYLPDEEDPSGNKAK
SQ RQRSTLAWQKPIQDCGSAVTERPKAAPIPTVNPEGKLKKEPNMFSPTLMLPGLGTLSSSQ
SQ MYPACSQMPTQPAQLGPGKQDTLHSCWQQLYSPSPSASSLLSLHSHSSFTAEVPQPGAQG
SQ SSSLPAYNPLNWPDEKNSSFYRNFGNTHGMGAALVSAAGMQSVSSSSIVQGTHQASATTA
SQ SIMTMPRTPGEVPFLRQQVGYRS
XX
SC Swiss-Prot#P01126
XX
FT 13 190 
PS50254; REL_2.
FT 18 186 
PF00554; Rel homology domain (RHD).
FT 27 35 
essential for IkappaB-alpha binding [14].
FT 193 288 
SM00429; iptmega2.
FT 194 288 
PF01833; IPT/TIG domain.
XX
SF lacking the strong trans-activation domain found in c-Rel [10];
SF the IkappaB-contacting motif RXXRXRXXC is highly conserved among Rel-like factors and is part of the DNA-binding loop 1 in NF-kappaB1 (p50) [14];
SF C-terminally adjacent to the Rel domain is a trans-activating domain which is active in undifferentiated cells only [8] [16];
SF it interacts directly with TBP [11];
SF interaction with IkappaB-alpha and -beta does not prevent DNA-binding [3] [12];
XX
FF competitively inhibits NF-kappaB and c-Rel to activate kappaB sites [1] [9] [13];
FF in contrast to c-rel, v-Rel enhances the activating effect of Sp1 [15];
XX
IN T00168 c-Rel; human, Homo sapiens.
IN T00169 c-Rel; mouse, Mus musculus.
IN T01154 c-Rel; chick, Gallus gallus.
IN T00950 IkappaB-alpha; human, Homo sapiens.
IN T01937 IkappaB-alpha; chick, Gallus gallus.
IN T00416 IkappaB-beta; chick, Gallus gallus.
IN T00971 IkappaB-beta; mouse, Mus musculus.
IN T01924 NF-kappaB1-isoform1; mouse, Mus musculus.
IN T00593 NF-kappaB1-p50; human, Homo sapiens.
IN T01925 NF-kappaB1; human, Homo sapiens.
IN T00587 NF-kappaB; rat, Rattus norvegicus.
IN T00588 NF-kappaB; mouse, Mus musculus.
IN T00590 NF-kappaB; human, Homo sapiens.
IN T01923 p50; mouse, Mus musculus.
IN T00594 RelA-p65-isoform1; human, Homo sapiens.
IN T00595 RelA-p65; mouse, Mus musculus.
IN T00794 TBP; human, Homo sapiens.
IN T00796 TBP; mouse, Mus musculus.
IN T00897 v-Rel; REV-T, reticuloendotheliosis virus (strain T).
XX
BS R01748.
BS R02668.
BS R01058.
BS R55836.
XX
DR TRANSPATH: MO000025252.
DR EMBL: K00555;
DR UniProtKB: P01126;
XX
RN [1]; RE0000216.
RX PUBMED: 2225078.
RA Ballard D. W., Walker W. H., Doerre S., Sista P., Molitor J. A., Dixon E. P., Peffer N. J., Hannink M., Greene W. C.
RT The v-rel oncogene encodes a kappaB enhancer binding protein that inhibits NF-kappaB function
RL Cell 63:803-814 (1990).
RN [2]; RE0000517.
RX PUBMED: 1675604.
RA Logeat F., Israel N., Ten R., Blank V., Le Bail O., Kourilsky P., Israel A.
RT Inhibition of transcription factors belonging to the rel/NF-kappaB family by a transdominant negative mutant
RL EMBO J. 10:1827-1832 (1991).
RN [3]; RE0000762.
RX PUBMED: 1907941.
RA Kerr L. D., Inoue J.-I., Davis N., Link E., Baeuerle P. A., Bose jr H. R., Verma I. M.
RT The Rel-associated pp40 protein prevents DNA binding of Rel and NF-kappaB: relationship with IkappaBbeta and regulation by phosphorylation
RL Genes Dev. 5:1464-1476 (1991).
RN [4]; RE0002464.
RX PUBMED: 1848011.
RA Kabrun N., Hodgson J. W., Doemer M., Mak G., Franza jr B. R., Enrietto P. J.
RT Interaction of the v-rel protein with an NF-kappaB DNA binding site
RL Proc. Natl. Acad. Sci. USA 88:1783-1787 (1991).
RN [5]; RE0002477.
RX PUBMED: 2023921.
RA Inoue J.-I., Kerr L. D., Ransone L. J., Bengal E., Hunter T., Verma I. M.
RT c-rel activates but v-rel suppresses transcription from kappaB sites
RL Proc. Natl. Acad. Sci. USA 88:3715-3719 (1991).
RN [6]; RE0004484.
RX PUBMED: 6090694.
RA Wilhelmsen K. C., Eggleton K., Temin H. M.
RT Nucleic acid sequences of the oncogene v-rel in reticuloendotheliosis virus strain T and its cellular homolog, the proto-oncogene c-rel
RL J. Virol. 52:172-182 (1984).
RN [7]; RE0004485.
RX PUBMED: 6312449.
RA Stephens R. M., Rice N. R., Hiebsch R. R., Bose H. R., Gilden R. V.
RT Nucleotide sequence of v-rel: the oncogene of reticuloendotheliosis virus
RL Proc. Natl. Acad. Sci. USA 80:6229-6233 (1983).
RN [8]; RE0004489.
RX PUBMED: 8336947.
RA Sarkar S., Gilmore T. D.
RT Transformation by the v-rel oncoprotein requires sequences carboxy-terminal to the rel homology domain
RL Oncogene 8:2245-2252 (1993).
RN [9]; RE0004558.
RX PUBMED: 1542686.
RA Ballard D. W., Dixon E. P., Peffer N. J., Bogerd H., Doerre S., Stein B., Greene W. C.
RT The 65-kDa subunit of human NF-kappaB functions as a potent transcriptional activator and a target for v-Rel-mediated repression
RL Proc. Natl. Acad. Sci. USA 89:1875-1879 (1992).
RN [10]; RE0004574.
RX PUBMED: 1903456.
RA Richardson P. M., Gilmore T. D.
RT vRel is an inactive member of the Rel family of transcriptional activating proteins
RL J. Virol. 65:3122-3130 (1991).
RN [11]; RE0004579.
RX PUBMED: 8413269.
RA Xu X., Prorock C., Ishikawa H., Maldonado E., Ito Y., GJlinas C.
RT Functional interaction of the v-Rel and c-Rel oncoproteins with the TATA-binding protein and association with transcription factor IIB
RL Mol. Cell. Biol. 13:6733-6741 (1993).
RN [12]; RE0004582.
RX PUBMED: 8441412.
RA Diehl A., McKinsey T. A., Hannink M.
RT Differential pp40IkappaB-beta inhibition of DNA binding by rel proteins
RL Mol. Cell. Biol. 13:1769-1778 (1993).
RN [13]; RE0004583.
RX PUBMED: 1741161.
RA McDonnell P. C., Kumar S., Rabson A. B., GJlinas C.
RT Transcriptional activity of rel family proteins
RL Oncogene 7:163-170 (1992).
RN [14]; RE0004584.
RX PUBMED: 8415639.
RA Kumar S., GJlinas C.
RT IkappaBalpha-mediated inhibition of v-Rel DNA binding requires direct interaction with the RXXRXRXXC Rel/kappaB DNA-binding motif
RL Proc. Natl. Acad. Sci. USA 90:8962-8966 (1993).
RN [15]; RE0004585.
RX PUBMED: 8361761.
RA Sif S., Capobianco A. J., Gilmore T. D.
RT The v-Rel oncoprotein increases expression from Sp1 site-containing promoters in chicken embryo fibroblasts
RL Oncogene 8:2501-2509 (1993).
RN [16]; RE0004686.
RX PUBMED: 1321284.
RA Walker W. H., Stein B., Ganchi P. A., Hoffman J. A., Kaufman P. A., Ballard D. W., Hannink M., Greene W. C.
RT The v-rel oncogene: insights into the mechanism of transcriptional activation, repression, and transformation
RL J. Virol. 66:5018-5029 (1992).
XX
//