TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01927 XX ID T01927 XX DT 04.11.1996 (created); ewi. DT 22.05.2014 (updated); yre. CO Copyright (C), QIAGEN. XX FA NF-kappaB2-p100 XX SY H2TF1; NF-kappaB2 (p100); NF-kappaB2 (p97); NF-kappaB2 precursor; p100; p97; p98/p55. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006466 NFKB2; HGNC: NFKB2. XX CL C0020; Rel; 6.1.1.1.2.1. XX SZ 900 AA; 96.7 kDa (cDNA) (calc.), 100 kDa (SDS) XX SQ MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP SQ SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC SQ AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE SQ LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV SQ RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE SQ RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS SQ GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA SQ AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL SQ LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT SQ SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG SQ LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN SQ VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP SQ EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ SQ LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL SQ EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH XX SC Swiss-Prot#Q00653-1 XX SF DNA-binding precursor of mature NF-kappaB2 (p52) [4] [5]; SF KD for binding to a kappaB site is 30 pM [4]; SF an alternative splice variant is p49 [1]; XX CP ubiquitous. XX FF heterodimers with RelB or c-Rel are retained in the cytoplasm unless an appropriate stimulus causes phosphorylation and proteolytic processing of the precursor with concomitant NF-kappaB2 (p52) release [3] [5] [6]; XX IN T00168 c-Rel; human, Homo sapiens. IN T00593 NF-kappaB1-p50; human, Homo sapiens. IN T00594 RelA-p65-isoform1; human, Homo sapiens. IN T01931 RelB; human, Homo sapiens. XX MX M00774 V$NFKB_Q6_01. XX DR TRANSPATH: MO000019365. DR EMBL: S76638; S76638. DR EMBL: U09609; HS09609. DR EMBL: X61498; HSNFKBS. DR EMBL: X78674; HSNFKB2I. DR UniProtKB: Q00653-1; XX RN [1]; RE0001873. RX PUBMED: 1876189. RA Schmid R. M., Perkins N. D., Duckett C. S., Andrews P. C., Nabel G. J. RT Cloning of an NF-kappaB subunit which stimulates HIV transcription in synergy with p65 RL Nature 352:733-736 (1991). RN [2]; RE0002005. RX PUBMED: 2566973. RA Fujita T., Miyamoto M., Kimura Y., Hammer J., Taniguchi T. RT Involvement of a cis-element that binds an H2TF-1/NFkappaB like factor(s) in the virus-induced interferon-beta gene expression RL Nucleic Acids Res. 17:3335-3346 (1989). RN [3]; RE0004507. RX PUBMED: 7925300. RA Naumann M., Scheidereit C. RT Activation of NF-6B in vivo is regulated by multiple phosphorylations RL EMBO J. 13:4597-4607 (1994). RN [4]; RE0004534. RX PUBMED: 8360178. RA Potter D. A., Larson C. J., Eckes P., Schmid R. M., Nabel G. J., Verdine G. L., Sharp P. A. RT Purification of the major histocompatibility complex class I transcription factor H2TF1. The full-length product of the nfkb2 gene RL J. Biol. Chem. 268:18882-18890 (1993). RN [5]; RE0004538. RX PUBMED: 8458581. RA Mercurio F., Didonato J. A., Rosette C., Karin M. RT p105 and p98 precursor proteins play an active role in NF-kappaB-mediated signal transduction RL Genes Dev. 7:705-718 (1993). RN [6]; RE0004539. RX PUBMED: 8413211. RA Scheinman R. I., Beg A. A., Baldwin jr A. S. RT NF-kappaB p100 (Lyt-10) is a component of H2TF1 and can function as an IkappaB-like molecule RL Mol. Cell. Biol. 13:6089-6101 (1993). RN [7]; RE0004636. RX PUBMED: 8439294. RA Zhang W. W., Zhang L.-X., Busch R. K., Farres J., Busch H. RT Purification and characterization of a DNA-binding heterodimer of 52 and 100 kDa from HeLa cells RL J. Biochem. 290:267-272 (1993). RN [8]; RE0029416. RX PUBMED: 11994270. RA Fong A., Sun S. C. RT Genetic Evidence for the Essential Role of beta -Transducin Repeat-containing Protein in the Inducible Processing of NF-kappa B2/p100. RL J. Biol. Chem. 277:22111-4 (2002). RN [9]; RE0030779. RX PUBMED: 12556537. RA Muller J. R., Siebenlist U. RT Lymphotoxin beta receptor induces sequential activation of distinct NF-kappa B factors via separate signaling pathways. RL J. Biol. Chem. 278:12006-12 (2003). RN [10]; RE0044053. RX PUBMED: 15084608. RA Liao G., Zhang M., Harhaj E. W., Sun S. C. RT Regulation of the NF-kappaB-inducing kinase by tumor necrosis factor receptor-associated factor 3-induced degradation RL J. Biol. Chem. 279:26243-50 (2004). RN [11]; RE0051641. RX PUBMED: 15208311. RA Hu W. H., Mo X. M., Walters W. M., Brambilla R., Bethea J. R. RT TNAP, a novel repressor of NF-kappaB-inducing kinase, suppresses NF-kappaB activation. RL J. Biol. Chem. 279:35975-35983 (2004). RN [12]; RE0051644. RX PUBMED: 11239468. RA Xiao G., Harhaj E. W., Sun S. C. RT NF-kappaB-inducing kinase regulates the processing of NF-kappaB2 p100. RL Mol. Cell 7:401-409 (2001). RN [13]; RE0052978. RX PUBMED: 18022362. RA Varfolomeev E., Blankenship J. W., Wayson S. M., Fedorova A. V., Kayagaki N., Garg P., Zobel K., Dynek J. N., Elliott L. O., Wallweber H. J., Flygare J. A., Fairbrother W. J., Deshayes K., Dixit V. M., Vucic D. RT IAP antagonists induce autoubiquitination of c-IAPs, NF-kappaB activation, and TNFalpha-dependent apoptosis. RL Cell 131:669-681 (2007). RN [14]; RE0053642. RX PUBMED: 15140882. RA Xiao G., Fong A., Sun S. C. RT Induction of p100 processing by NF-kappaB-inducing kinase involves docking IkappaB kinase alpha (IKKalpha) to p100 and IKKalpha-mediated phosphorylation. RL J. Biol. Chem. 279:30099-30105 (2004). RN [15]; RE0053939. RX PUBMED: 12524526. RA Mordmuller B., Krappmann D., Esen M., Wegener E., Scheidereit C. RT Lymphotoxin and lipopolysaccharide induce NF-kappaB-p52 generation by a co-translational mechanism. RL EMBO Rep. 4:82-87 (2003). RN [16]; RE0053976. RX PUBMED: 15708970. RA Hauer J., Puschner S., Ramakrishnan P., Simon U., Bongers M., Federle C., Engelmann H. RT TNF receptor (TNFR)-associated factor (TRAF) 3 serves as an inhibitor of TRAF2/5-mediated activation of the noncanonical NF-kappaB pathway by TRAF-binding TNFRs. RL Proc. Natl. Acad. Sci. USA 102:2874-2879 (2005). RN [17]; RE0054072. RX PUBMED: 11687592. RA Solan N. J., Miyoshi H., Carmona E. M., Bren G. D., Paya C. V. RT RelB cellular regulation and transcriptional activity are regulated by p100. RL J. Biol. Chem. 277:1405-1418 (2002). RN [18]; RE0054105. RX PUBMED: 14676825. RA Amir R. E., Haecker H., Karin M., Ciechanover A. RT Mechanism of processing of the NF-kappa B2 p100 precursor: identification of the specific polyubiquitin chain-anchoring lysine residue and analysis of the role of NEDD8-modification on the SCF(beta-TrCP) ubiquitin ligase. RL Oncogene 23:2540-2547 (2004). RN [19]; RE0054132. RX PUBMED: 11726516. RA Xiao G., Cvijic M. E., Fong A., Harhaj E. W., Uhlik M. T., Waterfield M., Sun S. C. RT Retroviral oncoprotein Tax induces processing of NF-kappaB2/p100 in T cells: evidence for the involvement of IKKalpha. RL EMBO J. 20:6805-6815 (2001). RN [20]; RE0054190. RX PUBMED: 12820969. RA Saccani S., Pantano S., Natoli G. RT Modulation of NF-kappaB activity by exchange of dimers. RL Mol. Cell 11:1563-1574 (2003). RN [21]; RE0063550. RX PUBMED: 18292573. RA Madge L. A., Kluger M. S., Orange J. S., May M. J. RT Lymphotoxin-alpha 1 beta 2 and LIGHT induce classical and noncanonical NF-kappa B-dependent proinflammatory gene expression in vascular endothelial cells. RL J. Immunol. 180:3467-3477 (2008). XX //