TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00176 XX ID T00176 XX DT 15.10.1992 (created); ewi. DT 23.10.2008 (updated); smt. CO Copyright (C), QIAGEN. XX FA CTF-1 XX SY CAAT-binding transcription factor 1; CTF-1; CTF1; NF-1; NFI/CTF-1; NFIC isoform 4; NFIC4. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003997 NFIC; HGNC: NFIC. XX CL C0060; NF1; 7.1.2.0.3.4. XX SZ 507 AA; 55.6 kDa (cDNA) (calc.). XX SQ MYSSLCLTMDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDEL SQ LGEKPEVKQKWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCL SQ RQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLA SQ YFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVT SQ GTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYT SQ SPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHS SQ GIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQP SQ GPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDT SQ SPANRSFVGLGPRDPAGIYQAQSWYLG XX SC edited Swiss-Prot #P08651 XX FT 1 194 PS51080; CTF_NFI_2. FT 9 229 DNA-binding, dimerization and replication stimulating domain [1]. FT 24 367 PF00478; IMP dehydrogenase / GMP reductase domain. FT 65 172 PF03165; MH1 domain. FT 67 175 SM00523; dwAneu5. FT 76 159 region containing some residues exclusively important for replication functions [7]. FT 216 507 PF00859; CTF/NF-I family transcription modulation reg. FT 396 495 proline-rich (23/100) trans-activating region [2]. FT 468 487 most important part of the trans-activating region [6]. XX SF 6 splice variants are known: NF-1 T00539, CTF1 (this entry), CTF-2 T00177, CTF-3 T00178, CTF-5 T02300, CTF-7 T02301 [9] [11]; SF different N-termini have been reported, positions are recalculated for the 507 AA-sequence; SF at least 7 splice variants are encoded by the CTF gene; SF CTF-1 is encoded by exons 1-11; SF three Cys residues are essential for DNA-binding (Cys-95, -148, -154) [5]; SF the trans-activating domain is encoded by exons 7-9 the expression of which differs in all splice variants [9]; SF interaction with co-activators is required for trans-activation [4]; SF direct interaction with TFIIB facilitates recruitment of TFIIB to the preinitiation complex [10]; XX CP widespread. CN B cells, T cells [3]. XX FF activator [2]; FF stimulator of (adenoviral) DNA replication [2]; FF facilitating assembly of basal transcription complex [4]; FF competing with histones, esp. with H5 [4]; FF concluded to act as a cofactor in the context of the p53 promoter [13]; XX IN T00176 CTF-1; human, Homo sapiens. IN T02054 HOX11; human, Homo sapiens. IN T00594 RelA-p65-isoform1; human, Homo sapiens. IN T00818 TFIIB; human, Homo sapiens. XX MX M01196 V$CTF1_01. MX M00056 V$MYOGNF1_01. MX M07300 V$NF1C_Q6. MX M07363 V$NF1FAMILY_Q4. MX M00193 V$NF1_Q6. MX M00806 V$NF1_Q6_01. MX M07364 V$NF1_Q6_02. XX BS R01175. BS R25647. BS R25649. BS R25650. BS R25651. BS R25652. BS R25653. BS R25654. BS R25655. BS R25656. BS R25657. BS R25658. BS R25659. BS R25660. BS R25661. BS R25662. BS R25663. BS R00506. BS R01311. BS R16681. BS R16684. BS R02209. XX DR TRANSPATH: MO000024751. DR EMBL: X12492; DR UniProtKB: P08651-1; XX RN [1]; RE0000148. RX PUBMED: 2504497. RA Mermod N., O'Neill E. A., Kelly T. J., Tjian R. RT The Proline-Rich Transcriptional Activator of CTF/NF-I Is Distinct from the Replication and DNA Binding Domain RL Cell 58:741-753 (1989). RN [2]; RE0001784. RX PUBMED: 3398920. RA Santoro C., Mermod N., Andrews P. C., Tjian R. RT A family of human CCAAT-box-binding proteins active in transcription and DNA replication: cloning and expression of multiple cDNAs RL Nature 334:218-224 (1988). RN [3]; RE0003048. RX PUBMED: 1754398. RA McQuillan J. J., Rosen G. D., Birkenmeier T. M., Dean D. C. RT Identification of a protein that interacts with the nuclear factor-1 ( NF-1 ) binding site in cells that do not express NF-1: comparison to NF-1, cellular distribution, and effect on transcription RL Nucleic Acids Res. 19:6627-6631 (1991). RN [4]; RE0003049. RX PUBMED: 1406693. RA Dusserre Y., Mermod N. RT Purified cofactors and histone H1 mediate transcriptional regulation by CTF/NF-I RL Mol. Cell. Biol. 12:5228-5237 (1992). RN [5]; RE0003050. RX PUBMED: 1618796. RA Novak A., Goyal N., Gronostajski R. M. RT Four conserved cysteine residues are required for the DNA binding activity of nuclear factor I RL J. Biol. Chem. 267:12986-12990 (1992). RN [6]; RE0003051. RX PUBMED: 8121811. RA Kim T. K., Roeder R. G. RT CTD-like sequences are important for transcriptional activation by the proline-rich activation domain of CTF1 RL Nucleic Acids Res. 22:251-251 (1994). RN [7]; RE0003052. RX PUBMED: 7972097. RA Armentero M. T., Horwitz M., Mermod N. RT Targeting of DNA polymerase to the adenovirus prigin of DNA replication by interaction with nuclear factor I RL Proc. Natl. Acad. Sci. USA 91:11537-11541 (1994). RN [8]; RE0003053. RX PUBMED: 8041623. RA Wendler W., Altmann H., Winnacker E. L. RT Transcriptional activation of NF1/CTF1 depends on a sequence motif strongly related to the carboxyterminal domain of RNA polymerase II RL Nucleic Acids Res. 22:2601-2603 (1994). RN [9]; RE0003054. RX PUBMED: 8171010. RA Altmann H., Wendler W., Winnacker E. L. RT Transcriptional activation by CTF proteins is mediated by a bipartite low-proline domain RL Proc. Natl. Acad. Sci. USA 91:3901-3905 (1994). RN [10]; RE0004452. RX PUBMED: 8183887. RA Kim T. K., Roeder R. G. RT Proline-rich activator CTF1 targets the TFIIB assembly step during transcriptional activation RL Proc. Natl. Acad. Sci. USA 91:4170-4174 (1994). RN [11]; RE0006390. RX PUBMED: 8710515. RA Wenzelides S., Altmann H., Wendler W., Winnacker E.-L. RT CTF5- a new transcriptional activator of the NFI/CTF family RL Nucleic Acids Res. 24:2416-2421 (1996). RN [12]; RE0025475. RX PUBMED: 12568726. RA Grunder A., Qian F., Ebel T. T., Mincheva A., Lichter P., Kruse U., Sippel A. E. RT Genomic organization, splice products and mouse chromosomal localization of genes for transcription factor Nuclear Factor One. RL Gene 304:171-181 (2003). RN [13]; RE0035153. RX PUBMED: 12145335. RA Qin C., Nguyen T., Stewart J., Samudio I., Burghardt R., Safe S. RT Estrogen up-regulation of p53 gene expression in MCF-7 breast cancer cells is mediated by calmodulin kinase IV-dependent activation of a nuclear factor kappaB/CCAAT-binding transcription factor-1 complex. RL Mol. Endocrinol. 16:1793-1809 (2002). XX //