
AC T00539
XX
ID T00539
XX
DT 15.10.1992 (created); ewi.
DT 01.03.2016 (updated); sla.
CO Copyright (C), QIAGEN.
XX
FA NF-1C-isoform1
XX
SY CTF; CTF-1; CTF/NF-1; NF-1; NF-I; NF1C-isoform1; NFI; NFIC isoform 1; NFIC1; nuclear factor 1; TGGCA-binding protein.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003997 NFIC; HGNC: NFIC.
XX
CL C0060; NF1; 7.1.2.0.3.1.
XX
SZ 499 AA; 54.7 kDa (cDNA) (calc.).
XX
SQ MDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEVK
SQ QKWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWR
SQ LDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDA
SQ EQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTGTGPNFSL
SQ GELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSS
SQ SRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHP
SQ SSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGPLNGSGQ
SQ LKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFV
SQ GLGPRDPAGIYQAQSWYLG
XX
SC Swiss-Prot#P08651-2
XX
FT 1 186
PS51080; CTF_NFI_2.
FT 16 359
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 57 164
PF03165; MH1 domain.
FT 59 167
SM00523; dwAneu5.
FT 208 499
PF00859; CTF/NF-I family transcription modulation reg.
XX
SF 6 splice variants are known: NF-1C-isoform1 (this entry), CTF-1 T00176, CTF-2 T00177, CTF-3 T00178, CTF-5 T02300, CTF-7 T02301 [28] [29];
SF O-glycosylation;
XX
MX M01196 V$CTF1_01.
MX M00056 V$MYOGNF1_01.
MX M07300 V$NF1C_Q6.
MX M07363 V$NF1FAMILY_Q4.
MX M00193 V$NF1_Q6.
MX M00806 V$NF1_Q6_01.
MX M07364 V$NF1_Q6_02.
XX
BS R00347.
BS R00312.
BS R01175.
BS R01988.
BS R00167.
BS R00169.
BS R01774.
BS R00633.
BS R00636.
BS R00640.
BS R01367.
BS R00789.
BS R00790.
BS R00791.
BS R00792.
BS R00799.
BS R00802.
BS R00803.
BS R00809.
BS R00729.
BS R00730.
BS R00731.
BS R00732.
BS R00733.
BS R00734.
BS R00735.
BS R00738.
BS R00739.
BS R00740.
BS R00741.
BS R00744.
BS R00745.
BS R00746.
BS R00724.
BS R00725.
BS R00726.
BS R00727.
BS R00728.
BS R31699.
BS R20865.
BS R03664.
BS R00435.
BS R00457.
BS R04124.
BS R04125.
BS R04126.
BS R00607.
BS R00594.
BS R01311.
BS R11726.
BS R11730.
BS R26282.
BS R02705.
BS R00951.
BS R00952.
BS R00953.
BS R01126.
BS R00088.
BS R03106.
BS R04695.
BS R02209.
BS R01624.
BS R03993.
BS R03994.
BS R03995.
BS R18865.
BS R01357.
BS R01588.
BS R01589.
BS R04482.
BS R04483.
BS R04484.
XX
DR TRANSPATH: MO000009772.
DR TRANSCOMPEL: C00310.
DR TRANSCOMPEL: C00443.
DR EMBL: X12492;
DR UniProtKB: P08651-2;
XX
RN [1]; RE0000049.
RX PUBMED: 2830985.
RA Rossi P., Karsenty G., Roberts A. B., Roche N. S., Sporn M. B., de Crombrugghe B.
RT A Nuclear Factor I Binding Site Mediates the Transcriptional Activation of a Type I Collagen Promoter by Transforming Growth Factor-beta
RL Cell 52:405-414 (1988).
RN [2]; RE0000315.
RX PUBMED: 2767055.
RA Cleat P. H., Hay R. T.
RT Co-operative interactions between NFI and the adenovirus DNA binding protein at the adenovirus origin of replication
RL EMBO J. 8:1841-1848 (1989).
RN [3]; RE0000364.
RX PUBMED: 3015602.
RA Hennighausen L., Fleckenstein B.
RT Nuclear factor 1 interacts with five DNA elements in the promoter region of the human cytomegalovirus major immediate early gene
RL EMBO J. 5:1367-1371 (1986).
RN [4]; RE0000403.
RX PUBMED: 3463507.
RA Shaul Y., Ben-Levy R., De-Medina T.
RT High affinity binding site for nuclear factor I next to the hepatitis B virus S gene promotor
RL EMBO J. 5:1967-1971 (1986).
RN [5]; RE0000459.
RX PUBMED: 2303041.
RA Gounari F., de Francesco R., Schmitt J., van der Vliet P., Cortese R., Stunnenberg H.
RT Amino-terminal domain of NF1 binds to DNA as a dimer and activates adenovirus DNA replication
RL EMBO J. 9:559-566 (1990).
RN [6]; RE0000653.
RX PUBMED: 2542124.
RA Toohey M. G., Jones K. A.
RT In vitro formation of short RNA polymerase II transcripts that terminate within the HIV-1 and HIV-2 promoter-proximal downstream regions
RL Genes Dev. 3:265-282 (1989).
RN [7]; RE0000812.
RX PUBMED: 2540170.
RA Amemiya K., Traub R., Durham L., Major E. O.
RT Interaction of a Nuclear Factor-1-like Protein with the Regulatory Region of Human Polyomavirus JC Virus
RL J. Biol. Chem. 264:7025-7032 (1989).
RN [8]; RE0000835.
RX PUBMED: 3005289.
RA Adhya S., Shneidman P. S., Hurwitz J.
RT Reconstruction of adenovirus replication origins with a human nuclear factor I binding site
RL J. Biol. Chem. 261:3339-3346 (1986).
RN [9]; RE0000874.
RX PUBMED: 3003068.
RA Rosenfeld P. J., Kelly T. J.
RT Purification of Nuclear Factor I by DNA Recognition Site Affinity Chromatography
RL J. Biol. Chem. 261:1398-1408 (1986).
RN [10]; RE0001129.
RX PUBMED: 2926813.
RA Janson L., Weller P., Pettersson U.
RT Nuclear Factor I can Functionally Replace Transcription Factor Sp1 in a U2 Small Nuclear RNA Gene Enhancer
RL J. Mol. Biol. 205:387-396 (1989).
RN [11]; RE0001160.
RX PUBMED: 2214023.
RA Mul Y. M., Verrijzer C. P., van der Vliet P. C.
RT Transcription factors NFI and NFIII/oct-1 function independently, employing different mechanisms to enhance adenovirus DNA replication
RL J. Virol. 64:5510-5518 (1990).
RN [12]; RE0001209.
RX PUBMED: 3785168.
RA Diffley J. F. X., Stillman B.
RT Purification of a cellular, double-stranded DNA-binding protein required for initiation of adenovirus DNA replication by using a rapid filter-binding assay
RL Mol. Cell. Biol. 6:1363-1373 (1986).
RN [13]; RE0001247.
RX PUBMED: 2542772.
RA Dean D. C., Blakeley M. S., Newby R. F., Ghazal P., Hennighausen L., Bourgeois S.
RT Forskolin Inducibility and Tissue-Specific Expression of the Fibronectin Promoter
RL Mol. Cell. Biol. 9:1498-1506 (1989).
RN [14]; RE0001274.
RX PUBMED: 2725524.
RA Ben-Levy R., Faktor O., Berger I., Shaul Y.
RT Cellular Factors That Interact with the Hepatitis B Virus Enhancer
RL Mol. Cell. Biol. 9:1804-1809 (1989).
RN [15]; RE0001374.
RX PUBMED: 2796988.
RA Gustafson T. A., Kedes L.
RT Identification of Multiple Proteins That Interact with Functional Regions of the Human Cardiac alpha-Actin Promoter
RL Mol. Cell. Biol. 9:3269-3283 (1989).
RN [16]; RE0001385.
RX PUBMED: 2550803.
RA Chakraborty T., Das G. C.
RT Identification of HeLa Cell Nuclear Factors That Bind to and Activate the Early Promoter of Human Polyomavirus BK In Vitro
RL Mol. Cell. Biol. 9:3821-3828 (1989).
RN [17]; RE0001489.
RX PUBMED: 2304457.
RA Goyal N., Knox J., Gronostajski R. M.
RT Analysis of multiple forms of nuclear factor I in human and murine cell lines
RL Mol. Cell. Biol. 10:1041-1048 (1990).
RN [18]; RE0001631.
RX PUBMED: 1710025.
RA Pecorino L. T., Darrow A. L., Strickland S.
RT In vitro analysis of the tissue plasminogen activator promoter reveals a GC box-binding activity present in murine brain but undetectable in kidney and liver
RL Mol. Cell. Biol. 11:3139-3147 (1991).
RN [19]; RE0001814.
RX PUBMED: 2833704.
RA Mermod N., Williams T. J., Tjian R.
RT Enhancer binding factors AP-4 and AP-1 act in concert to activate SV40 late transcription in vitro
RL Nature 332:557-561 (1988).
RN [20]; RE0001971.
RX PUBMED: 2959908.
RA Garcia J., Wu F., Gaynor R.
RT Upstream regulatory regions required to stabilize binding to the TATA sequence in an adenovirus early promoter
RL Nucleic Acids Res. 15:8367-8385 (1987).
RN [21]; RE0001981.
RX PUBMED: 2734104.
RA Catala F., deBoer E., Habets G., Grosveld F.
RT Nuclear protein factors and erythroid transcription of the human Agamma-globin gene
RL Nucleic Acids Res. 17:3811-3827 (1989).
RN [22]; RE0001985.
RX PUBMED: 2308836.
RA Courtois S. J., Lafontaine D. A., Lemaigre F. P., Durviaux S. M., Rousseau G. G.
RT Nuclear factor-I and activator protein-2 bind in a mutually exclusive way to overlapping promoter sequences and trans-activate the human growth hormone gene
RL Nucleic Acids Res. 18:57-64 (1990).
RN [23]; RE0001991.
RX PUBMED: 2542901.
RA Gloss B., Yeo-Gloss M., Meisterernst M., Rogge L., Winnacker E. L., Bernard H.-U.
RT Clusters of nuclear factor I binding sites identify enhancers of several papillomaviruses but lone are not sufficient for enhancer function
RL Nucleic Acids Res. 17:3519-3533 (1989).
RN [24]; RE0002057.
RX PUBMED: 2555785.
RA Shelbourn S. L., Kothari S. K., Sissons J. G. P., Sinclair J. H.
RT Repression of human cytomegalovirus gene expression associated with a novel immediate early regulatory region binding factor
RL Nucleic Acids Res. 17:9165-9171 (1989).
RN [25]; RE0002283.
RX PUBMED: 6588377.
RA Gronostajski R. M., Nagata K., Hurwitz J.
RT Isolation of human DNA sequences that bind to nuclear factor I, a host protein involved in adenovirus DNA replication
RL Proc. Natl. Acad. Sci. USA 81:4013-4017 (1984).
RN [26]; RE0002309.
RX PUBMED: 3035545.
RA Ghazal P., Lubon H., Fleckenstein B., Hennighausen L.
RT Binding of transcription factors and creation of a large nucleoprotein complex on the human cytomegalovirus enhancer
RL Proc. Natl. Acad. Sci. USA 84:3658-3662 (1987).
RN [27]; RE0002479.
RX PUBMED: 1902571.
RA Trujillo M. A., Letovsky J., Maguire H. F., Lopez-Cabrera M., Siddiqui A.
RT Functional analysis of a liver-specific enhancer of the hepatitis B virus
RL Proc. Natl. Acad. Sci. USA 88:3797-3801 (1991).
RN [28]; RE0003054.
RX PUBMED: 8171010.
RA Altmann H., Wendler W., Winnacker E. L.
RT Transcriptional activation by CTF proteins is mediated by a bipartite low-proline domain
RL Proc. Natl. Acad. Sci. USA 91:3901-3905 (1994).
RN [29]; RE0006390.
RX PUBMED: 8710515.
RA Wenzelides S., Altmann H., Wendler W., Winnacker E.-L.
RT CTF5- a new transcriptional activator of the NFI/CTF family
RL Nucleic Acids Res. 24:2416-2421 (1996).
XX
//