TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01930 XX ID T01930 XX DT 04.11.1996 (created); ewi. DT 10.07.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA NF-kappaB2-p49 XX SY p49. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006466 NFKB2; HGNC: NFKB2. XX CL C0020; Rel; 6.1.1.1.2.3. XX SZ 428 AA; 44.2 kDa (calc.). XX SQ MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP SQ SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC SQ AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE SQ LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV SQ RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE SQ RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS SQ GGAAGGYGGAGGGEGVLMEGGVKVREAVEEKNLGEAGRGLHACNPALWEAKAGRLPEIRS SQ SRPAWPTA XX SC Swiss-Prot#Q00653-3 XX SF the homodimer binds to a kappaB site (of HIV-1 LTR) with KD = 69.1 pM, i. e. with 6-fold lower affinity than p49/p65 heterodimers (KD= 11.8 pM), and even less than p50 homodimers [2]; XX CP ubiquitous. XX FF activator when present as heterodimer with RelA (p65) through certain kappaB sites (such as GGGGACTTTCC), but inactive at others (e. g., GGGAATCCC of MHC H-2 genes) despite higher binding affinity [2] [3]; FF the p49/p65 heterodimer is under negative control of IkappaB-alpha [2]; XX IN T01930 NF-kappaB2-p49; human, Homo sapiens. IN T00594 RelA-p65-isoform1; human, Homo sapiens. XX MX M00774 V$NFKB_Q6_01. XX DR TRANSPATH: MO000007897. DR EMBL: X61499; DR UniProtKB: Q00653-3; NFKB2_HUMAN. XX RN [1]; RE0001873. RX PUBMED: 1876189. RA Schmid R. M., Perkins N. D., Duckett C. S., Andrews P. C., Nabel G. J. RT Cloning of an NF-kappaB subunit which stimulates HIV transcription in synergy with p65 RL Nature 352:733-736 (1991). RN [2]; RE0004541. RX PUBMED: 8441377. RA Duckett C. S., Perkins N. D., Kowalik T. F., Schmid R. M., Huang E.-S., Baldwin jr A. S., Nabel G. J. RT Dimerization of NF-KB2 with RelA(p65) regulates DNA binding, transcriptional activation, and inhibition by an IkappaB-alpha (MAD-3) RL Mol. Cell. Biol. 13:1315-1322 (1993). RN [3]; RE0004542. RX PUBMED: 1542644. RA Perkins N. D., Schmid R. M., Duckett C. S., Leung K., Rice N. R., Nabel G. J. RT Distinct combinations of NF-kappaB subunits determine the specificity of transcriptional activation RL Proc. Natl. Acad. Sci. USA 89:1529-1533 (1992). XX //