TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T03731 XX ID T03731 XX DT 23.08.2000 (created); bme. DT 15.05.2014 (updated); ili. CO Copyright (C), QIAGEN. XX FA PPARgamma2 XX SY NR1C3; peroxisome proliferator-activated receptor gamma; peroxisome-proliferator-activated receptor gamma 2; PPARgamma. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004022 PPARG; HGNC: PPARG. XX CL C0002; CC (rec); 2.1.2.5.3.2. XX SZ 505 AA; 57.6 kDa (cDNA) (calc.). XX SQ MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF SQ DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT SQ QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC SQ RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR SQ ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE SQ QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS SQ LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII SQ LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL SQ LQVIKKTETDMSLHPLLQEIYKDLY XX SC translated from EMBL #U79012 XX FT 3 380 PF00478; IMP dehydrogenase / GMP reductase domai. FT 136 206 SM00399; c4gold. FT 136 210 PS51030; NUCLEAR_REC_DBD_2. FT 137 211 PF00105; Zinc finger, C4 type (two domains). FT 315 474 SM00430; holi. FT 318 500 PF00104; Ligand-binding domain of nuclear hormon. XX SF One of four known variants of T05351; SF PPARgamma2 binds to PPREs (PPARgamma response elements) as a heterodimer with retinoid X receptor (RXR) T01345, T01334 [5]; SF PPARgamma2 and RXR T01345, T01334 cooperatively activate transcription [5]; XX CP adipocytes, bone marrow, skeletal muscle, spleen, testis, brain and liver [4]; heart, pancreas [5]; adipocytes [8] [4] [5] [8]. CN large intestine [8]. XX FF activator as a heterodimer with RXR-alpha [8]; FF PPARgamma2 is minor isoform in man [8]; FF ligands: fibrates, fatty acids, prostanoids, thiazolidinediones (anti-diabetic drugs) [2]; FF overexpression of PPARgamma2 in fibroblast cell lines converts them to adipocytes [7]; FF PPARgamma2 has reduced ability to promote adipocyte differentiation when phosphorylated at the amino acid corresponding to serine 112 in the human factor [3] [1]; FF mRNA for gamma2 is rapidly and transiently increased upon insulin treatment [9]; FF in the early stages of adipogenesis, gamma2 mRNA is induced by C/EBP [10]; XX IN T08861 NCOR1-isoform1; human, Homo sapiens. IN T01427 p300; human, Homo sapiens. IN T23091 p300; Mammalia. IN T05296 PGC-1; mouse, Mus musculus. IN T01331 RXR-alpha; mouse, Mus musculus. IN T01345 RXR-alpha; human, Homo sapiens. IN T21552 SRC-1; Mammalia. XX MX M00763 V$PPARDR1_Q2. MX M00512 V$PPARG_01. MX M00515 V$PPARG_02. MX M00528 V$PPARG_03. MX M01270 V$PPARG_Q6. XX BS R22744. XX DR TRANSPATH: MO000019616. DR PATHODB: MT010526. DR PATHODB: MT010527. DR PATHODB: MT010528. DR PATHODB: MT010531. DR PATHODB: MT010532. DR PATHODB: MT010533. DR PATHODB: MT010534. DR EMBL: U79012; HSU79012. DR UniProtKB: P37231-1; PPARG_HUMAN. XX RN [1]; RE0006367. RX PUBMED: 8953045. RA Hu E., Kim J. B., Sarraf P., Spiegelman B. M. RT Inhibition of adipogenesis through MAP kinease-mediated phosphorylation of PPAR RL Science 274:2100-2103 (1996). RN [2]; RE0011947. RX PUBMED: 7768881. RA Lehmann J. M., Moore L. B., Smith-Oliver T. A., Wilkison W. O., Willson T. M., Kliewer S. A. RT An antidiabetic thiazolidinedione is a high affinity ligand for peroxisome proliferator-activated receptor gamma (PPAR gamma). RL J. Biol. Chem. 270:12953-12956 (1995). RN [3]; RE0015013. RX PUBMED: 9753710. RA Ristow M., Muller-Wieland D., Pfeiffer A., Krone W., Kahn C. R. RT Obesity associated with a mutation in a genetic regulator of adipocyte differentiation RL N. Engl. J. Med. 339:953-959 (1998). RN [4]; RE0015014. RX PUBMED: 8702406. RA Elbrecht A., Chen Y., Cullinan C. A., Hayes N., Leibowitz M. D., Moller D. E., Berger J. RT Molecular cloning, expression and characterization of human peroxisome proliferator activated receptors gamma 1 and gamma 2 RL Biochem. Biophys. Res. Commun. 224:431-437 (1996). RN [5]; RE0015015. RX PUBMED: 9065481. RA Mukherjee R., Jow L., Croston G. E., Paterniti jr J. R. RT Identification, characterization, and tissue distribution of human peroxisome proliferator-activated receptor (PPAR) isoforms PPARgamma2 versus PPARgamma1 and activation with retinoid X receptor agonists and antagonists RL J. Biol. Chem. 272:8071-8076 (1997). RN [6]; RE0015017. RX PUBMED: 10622252. RA Barroso I., Gurnell M., Crowley V. E., Agostini M., Schwabe J. W., Soos M. A., Maslen G. L., Williams T. D., Lewis H., Schafer A. J., Chatterjee V. K., ORahilly S. RT Dominant negative mutations in human PPARgamma associated with severe insulin resistance, diabetes mellitus and hypertension RL Nature 402:880-883 (1999). RN [7]; RE0015018. RX PUBMED: 8001151. RA Tontonoz P., Hu E., Spiegelman B. M. RT Stimulation of adipogenesis in fibroblasts by PPAR gamma 2, a lipid-activated transcription factor RL Cell 79:1147-1156 (1994). RN [8]; RE0018211. RX PUBMED: 9228052. RA Fajas L., Auboeuf D., Raspe E., Schoonjans K., Lefebvre A. M., Saladin R., Najib J., Laville M., Fruchart J. C., Deeb S., Vidal-Puig A., Flier J., Briggs M. R., Staels B., Vidal H., Auwerx J. RT The organization, promoter analysis, and expression of the human PPARgamma gene. RL J. Biol. Chem. 272:18779-18789 (1997). RN [9]; RE0018235. RX PUBMED: 10102684. RA Rieusset J., Andreelli F., Auboeuf D., Roques M., Vallier P., Riou J. P., Auwerx J., Laville M., Vidal H. RT Insulin acutely regulates the expression of the peroxisome proliferator-activated receptor-gamma in human adipocytes. RL Diabetes 48:699-705 (1999). RN [10]; RE0018247. RX PUBMED: 9950217. RA Saladin R., Fajas L., Dana S., Halvorsen Y. D., Auwerx J., Briggs M. RT Differential regulation of peroxisome proliferator activated receptor gamma1 (PPARgamma1) and PPARgamma2 messenger RNA expression in the early stages of adipogenesis. RL Cell Growth Differ. 10:43-48 (1999). RN [11]; RE0030488. RX PUBMED: 12507421. RA Picard F., Gehin M., Annicotte J., Rocchi S., Champy M. F., O'Malley B. W., Chambon P., Auwerx J. RT SRC-1 and TIF2 control energy balance between white and brown adipose tissues. RL Cell 111:931-41 (2002). RN [12]; RE0047682. RX PUBMED: 12040021. RA Brendel C., Gelman L., Auwerx J. RT Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. RL Mol. Endocrinol. 16:1367-1377 (2002). RN [13]; RE0047776. RX PUBMED: 16260612. RA Sarruf D. A., Iankova I., Abella A., Assou S., Miard S., Fajas L. RT Cyclin D3 promotes adipogenesis through activation of peroxisome proliferator-activated receptor gamma. RL Mol. Cell. Biol. 25:9985-9995 (2005). RN [14]; RE0047782. RX PUBMED: 12444922. RA Babb R., Bowen B. R. RT SDP1 is a peroxisome-proliferator-activated receptor gamma 2 co-activator that binds through its SCAN domain. RL Biochem. J. 370:719-727 (2003). RN [15]; RE0047810. RX PUBMED: 14701856. RA Debril M. B., Gelman L., Fayard E., Annicotte J. S., Rocchi S., Auwerx J. RT Transcription factors and nuclear receptors interact with the SWI/SNF complex through the BAF60c subunit. RL J. Biol. Chem. 279:16677-16686 (2004). RN [16]; RE0047832. RX PUBMED: 15615782. RA Patel H., Truant R., Rachubinski R. A., Capone J. P. RT Activity and subcellular compartmentalization of peroxisome proliferator-activated receptor alpha are altered by the centrosome-associated protein CAP350. RL J. Cell Sci. 118:175-186 (2005). RN [17]; RE0050196. RX PUBMED: 15987634. RA Bouaboula M., Hilairet S., Marchand J., Fajas L., Le Fur G., Casellas P. RT Anandamide induced PPARgamma transcriptional activation and 3T3-L1 preadipocyte differentiation. RL Eur. J. Pharmacol. 517:174-181 (2005). RN [18]; RE0050226. RX PUBMED: 16198309. RA Soares A. F., Nosjean O., Cozzone D., D'Orazio D., Becchi M., Guichardant M., Ferry G., Boutin J. A., Lagarde M., Geloen A. RT Covalent binding of 15-deoxy-delta12,14-prostaglandin J2 to PPARgamma. RL Biochem. Biophys. Res. Commun. 337:521-525 (2005). RN [19]; RE0050377. RX PUBMED: 11301062. RA Ferry G., Bruneau V., Beauverger P., Goussard M., Rodriguez M., Lamamy V., Dromaint S., Canet E., Galizzi J. P., Boutin J. A. RT Binding of prostaglandins to human PPARgamma: tool assessment and new natural ligands. RL Eur. J. Pharmacol. 417:77-89 (2001). RN [20]; RE0050415. RX PUBMED: 17095203. RA Awais M., Sato M., Umezawa Y. RT A fluorescent indicator to visualize ligand-induced receptor/coactivator interactions for screening of peroxisome proliferator-activated receptor gamma ligands in living cells. RL Biosens. Bioelectron. 22:2564-2569 (2007). XX //