AC T00209
XX
ID T00209
XX
DT 15.10.1992 (created); ewi.
DT 26.11.2006 (updated); vma.
CO Copyright (C), QIAGEN.
XX
FA E1A 13S protein
XX
SY E1A 13S protein.
XX
OS adenovirus type 2
OC viridae; ds-DNA nonenveloped viruses; adenoviridae
XX
SZ 289 AA; 31.8 kDa (calc.), 31.8 kDa
XX
SQ MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEE
SQ AVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVI
SQ DLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCG
SQ MFVYSPVSEPEPEPEPEPEPARPTRRPKLVPAILRRPTSPVSRECNSSTDSCDSGPSNTP
SQ PEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNESGQPLDLSCKRPRP
XX
FT 1 289 
PF02703; Early E1A protein.
FT 154 174 
C4 zinc finger motif [6].
FT 201 216 
required for DNA-binding [9].
FT 285 289 
potential nuclear localization sequence [1].
XX
FF interaction with CRE-BP1 or c-Fos may be indirect [3];
FF also shown for adenovirus type 5;
FF zinc finger interacts with basic region of TBP [6] [7];
FF DNA-binding is nonspecific and not required for trans-regulation of e.g. adenovirus E4 and human c-erbB2 promoter [8] [9];
XX
IN T00167 ATF-2-isoform1; human, Homo sapiens.
IN T01382 ATF-2; rat, Rattus norvegicus.
IN T00051 ATF; human, Homo sapiens.
IN T00122 c-Fos; mouse, Mus musculus.
IN T00123 c-Fos; human, Homo sapiens.
IN T00124 c-Fos; rat, Rattus norvegicus.
IN T00125 c-Fos; chick, Gallus gallus.
IN T00131 c-Jun; mouse, Mus musculus.
IN T00132 c-Jun; rat, Rattus norvegicus.
IN T00133 c-Jun; human, Homo sapiens.
IN T00134 c-Jun; chick, Gallus gallus.
IN T00135 c-Jun; hamster, Cricetulus sp.
IN T01486 p107; human, Homo sapiens.
IN T01427 p300; human, Homo sapiens.
IN T00722 pRb; human, Homo sapiens.
IN T00794 TBP; human, Homo sapiens.
XX
DR TRANSPATH: MO000045814.
DR EMBL: J01917; HACG.
DR EMBL: X02996; AD5001.
DR UniProtKB: P03254; E1A_ADE02.
DR UniProtKB: P03255; E1A_ADE05.
XX
RN [1]; RE0000135.
RX PUBMED: 2948653.
RA Moran E., Mathews M. B.
RT Multiple functional domains in the adenovirus E1A gene
RL Cell 48:177-178 (1987).
RN [2]; RE0000186.
RX PUBMED: 2142019.
RA Liu F., Green M. R. R.
RT A specific member of the ATF transcription factor family can mediate transcription activation by the adenovirus E1a protein
RL Cell 61:1217-1224 (1990).
RN [3]; RE0002247.
RX PUBMED: 1832215.
RA Maguire K., Shi X.-P., Horikoshi N., Rappaport J., Rosenberg M., Weinmann R.
RT Interactions between adenovirus E1A and members of the AP-1 family of cellular transcription factors
RL Oncogene 6:1417-1422 (1991).
RN [4]; RE0002386.
RX PUBMED: 2137928.
RA Boeuf H., Reimund B., Jansen-Duerr P., Kedinger C.
RT Differential activation of the E2F transcription factor by the adenovirus EIa and EIV products in F9 cells
RL Proc. Natl. Acad. Sci. USA 87:1782-1786 (1990).
RN [5]; RE0002909.
RX PUBMED: 1534143.
RA Rikitake Y., Moran E.
RT DNA-binding properties of the E1A-associated 300-Kilodalton protein
RL Mol. Cell. Biol. 12:2826-2836 (1992).
RN [6]; RE0006583.
RX PUBMED: 8146144.
RA Geisberg J. V., Lee W. S., Berk A. J., Riccardi R. P.
RT The zinc finger region of the adenovirus E1A transactivating domain complexes with the TATA box binding protein
RL Proc. Natl. Acad. Sci. USA 91:2488-2492 (1994).
RN [7]; RE0006584.
RX PUBMED: 9478126.
RA MacKay J. P., Crossley M.
RT Zinc fingers are sticking together
RL Trends Biochem. Sci. 23:1-4 (1998).
RN [8]; RE0007142.
RX PUBMED: 2969333.
RA Chatterjee P. K., Bruner M., Flint S. J., Harter M. L.
RT DNA-binding properties of an adenovirus 289R E1A protein.
RL EMBO J. 7:835-841 (1988).
RN [9]; RE0007143.
RX PUBMED: 1356975.
RA Zu Y.-L., Takamatsu Y., Zhao M.-J., Maekawa T., Handa H., Ishii S.
RT Transcriptional regulation by a point mutant of adenovirus-2 E1a product lacking DNA binding activity.
RL J. Biol. Chem. 267:20181-20187 (1992).
RN [10]; RE0013301.
RX PUBMED: 2138977.
RA Hu Q. J., Dyson N., Harlow E.
RT The regions of the retinoblastoma protein needed for binding to adenovirus E1A or SV40 large T antigen are common sites for mutations.
RL EMBO J. 9:1147-1155 (1990).
RN [11]; RE0013313.
RX PUBMED: 2968523.
RA Moran E.
RT A region of SV40 large T antigen can substitute for a transforming domain of the adenovirus E1A products.
RL Nature 334:168-170 (1988).
RN [12]; RE0013314.
RX PUBMED: 3000772.
RA Stabel S., Argos P., Philipson L.
RT The release of growth arrest by microinjection of adenovirus E1A DNA.
RL EMBO J. 4:2329-2336 (1985).
XX
//