
AC T00490
XX
ID T00490
XX
DT 10.11.1992 (created); ewi.
DT 24.09.2013 (updated); sla.
CO Copyright (C), QIAGEN.
XX
FA MAZ-isoform1
XX
SY MAZ; Myc-associated zinc finger protein; Pur-1; purine-binding transcription factor 1; SAF-1; serum amyloid A-activating factor; ZF87; Zif87.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002730 MAZ; HGNC: MAZ.
XX
CL C0001; CH.
XX
SZ 477 AA; 48.6 kDa (cDNA) (calc.), 58.5 kDa (SDS) [1]
XX
SQ MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQ
SQ SPFQAAPAPPPTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAAS
SQ TVDTAALKQPPAPPPPPPPVSAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASAL
SQ EKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQ
SQ LSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLS
SQ HSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVH
SQ STERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV
SQ CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW
XX
SC translated from EMBL #AB017335
XX
FT 40 73
MAPK phosphorylation site [7].
FT 59 421
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 127 292
responsible for autorepression [5].
FT 190 212
PF00096; zf-C2H2.
FT 190 212
SM00355; c2h2final6.
FT 190 217
PS50157; ZINC_FINGER_C2H2_2.
FT 279 301
PF00096; zf-C2H2.
FT 279 301
SM00355; c2h2final6.
FT 279 306
PS50157; ZINC_FINGER_C2H2_2.
FT 307 329
PF00096; zf-C2H2.
FT 307 329
SM00355; c2h2final6.
FT 307 334
PS50157; ZINC_FINGER_C2H2_2.
FT 337 360
PF00096; zf-C2H2.
FT 337 360
SM00355; c2h2final6.
FT 337 365
PS50157; ZINC_FINGER_C2H2_2.
FT 366 388
PF00096; zf-C2H2.
FT 366 388
SM00355; c2h2final6.
FT 366 393
PS50157; ZINC_FINGER_C2H2_2.
FT 392 413
SM00355; c2h2final6.
XX
SF 6 zinc fingers of C2H2-type [2];
SF proline-/alanine-rich region [1];
SF may have an N-terminal extension leading to a 87 kDa protein as mentioned in [2];
SF homologous to the rodent factors Pur-1 T02303 T02304 [3];
SF suggested to form homodimers as well as with SAF-2 T06574, another splice variant of the MAZ-isoform1 gene [7];
SF phosphorylated by MAP kinase in vitro [7];
XX
EX brain,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX heart,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX kidney (right and left),,,adult; none; Northern blot; RNA (undefined); [1].
EX liver,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX lung (right and left),,,adult; detectable; Northern blot; RNA (undefined); [1].
EX muscles,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX pancreas,,,adult; detectable; Northern blot; RNA (undefined); [1].
EX placenta,,,adult; detectable; Northern blot; RNA (undefined); [1].
XX
FF activator [4];
FF repressor [5] [6];
FF may be involved in transcriptional initiation and termination at the c-myc P2 promoter [1];
FF may be an important regulator of TATA-less promoters [4];
FF may function in establishing active transcription complexes on the serotonin 1a receptor gene promoter [4];
FF negative autoregulation: MAZ-isoform1 factor repress promoter of the MAZ-isoform1 gene [5];
FF autorepression is dependent on DNA binding activity [5];
FF histone deacetylases (HDAC) may be involved in repression by MAZ-isoform1 [5];
FF suggested to share binding sites with Sp1 T00759 [6];
FF co-expression of MAZ-isoform1/SAF-2 can considerably reduce its transactivation potential [7];
XX
IN T00140 c-Myc-isoform1; human, Homo sapiens.
IN T04106 HDAC1; human, Homo sapiens.
IN T04109 hdac2-isoform1; human, Homo sapiens.
IN T04110 HDAC3; human, Homo sapiens.
XX
MX M07297 V$MAZ_Q5.
MX M00649 V$MAZ_Q6.
MX M02023 V$MAZ_Q6_01.
XX
BS R00315.
BS R16659.
BS R16660.
BS R16661.
BS R16671.
BS R16672.
BS R16673.
BS R16674.
BS R16675.
BS R16676.
BS R16677.
BS R16678.
BS R04621.
BS R08503.
BS R04625.
BS R04626.
BS R04627.
BS R04628.
BS R04976.
BS R30357.
BS R02306.
BS R04622.
BS R12104.
BS R30354.
BS R30355.
XX
DR TRANSPATH: MO000024966.
DR EMBL: AB017335; AB017335.
DR EMBL: J05371;
DR EMBL: M94046;
DR UniProtKB: P56270;
XX
RN [1]; RE0002438.
RX PUBMED: 1502157.
RA Bossone St. A., Asselin C., Patel A. J., Marcu K. B.
RT MAZ, a zinc finger protein, binds to c-MYC and C2 gene sequences regulating transcriptional initiation and termination
RL Proc. Natl. Acad. Sci. USA 89:7452-7456 (1992).
RN [2]; RE0006393.
RX PUBMED: 1567856.
RA Pyrc J. J., Moberg K. H., Hall D. J.
RT Isolation of a novel cDNA encoding a zinc-finger protein that binds to two sites within the c-myc promoter
RL Biochemistry 31:4102-4110 (1992).
RN [3]; RE0006397.
RX PUBMED: 1454839.
RA Kennedy G. C., Rutter W. J.
RT Pur-1, a zinc finger protein that binds to purine-rich sequences, transactivates an insulin promoter in heterologous cells
RL Proc. Natl. Acad. Sci. USA 89:11498-11502 (1992).
RN [4]; RE0006461.
RX PUBMED: 8626793.
RA Parks C. L., Shenk T.
RT The serotonin 1a receptor gene contains a TATA-less promoter that responds to MAZ and Sp1
RL J. Biol. Chem. 271:4417-4430 (1996).
RN [5]; RE0035141.
RX PUBMED: 11259406.
RA Song J., Ugai H., Kanazawa I., Sun K., Yokoyama K. K.
RT Independent repression of a GC-rich housekeeping gene by Sp1 and MAZ involves the same cis-elements.
RL J. Biol. Chem. 276:19897-19904 (2001).
RN [6]; RE0035144.
RX PUBMED: 11395515.
RA Song J., Ugai H., Ogawa K., Wang Y., Sarai A., Obata Y., Kanazawa I., Sun K., Itakura K., Yokoyama K. K.
RT Two consecutive zinc fingers in Sp1 and in MAZ are essential for interactions with cis-elements.
RL J. Biol. Chem. 276:30429-30434 (2001).
RN [7]; RE0035146.
RX PUBMED: 12270922.
RA Ray B. K., Murphy R., Ray P., Ray A.
RT SAF-2, a splice variant of SAF-1, acts as a negative regulator of transcription.
RL J. Biol. Chem. 277:46822-46830 (2002).
XX
//