AC T09093
XX
ID T09093
XX
DT 16.06.2006 (created); rad.
DT 19.02.2015 (updated); ros.
CO Copyright (C), QIAGEN.
XX
FA ipf1
XX
SY IDX-1; insulin promoter factor 1; IPF-1; ISLET/duodenum homeobox-1; pancreas/duodenum homeobox 1; pancreas/duodenum homeobox-1; Pdx1; somatostatin transactivating factor 1; somatostatin transactivating factor-1; STF-1; STF1.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G002300 Pdx1.
XX
CL C0006; homeo.
XX
SZ 284 AA; 31.0 kDa (cDNA) (calc.), 46 kDa (SDS) [3]
XX
SQ MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFTSSLGSLEQG
SQ SPPDISPYEVPPLASDDPAGAHLHHHLPAQLGLAHPPPGPFPNGTEPGGLEEPNRVQLPF
SQ PWMKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVEL
SQ AVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGGEEPEQDCAVTSGEELLAVP
SQ PLPPPGGAVPPGVPAAVREGLLPSGLSVSPQPSSIAPLRPQEPR
XX
SC translated from EMBL #X74342
XX
FT 145 205 PS50071; HOMEOBOX_2.
FT 147 209 SM00389; HOX_1.
FT 148 204 PF00046; Homeobox domain.
XX
FF Pdx1, MafA, and Beta2 synergistically activate the insulin gene promoter in the hamster insulinoma-derived cell line In1024 [8];
XX
IN T08343 HDAC1; human, Homo sapiens.
IN T23418 HDAC1; mouse, Mus musculus.
IN T04109 hdac2-isoform1; human, Homo sapiens.
IN T04140 hdac2; mouse, Mus musculus.
IN T03388 meis1-a; mouse, Mus musculus.
IN T02897 Sox-6-Isoform1; mouse, Mus musculus.
XX
MX M01233 V$IPF1_01.
MX M01234 V$IPF1_02.
MX M01235 V$IPF1_03.
MX M01236 V$IPF1_04.
MX M01255 V$IPF1_05.
MX M01438 V$IPF1_06.
MX M00436 V$IPF1_Q4.
MX M01013 V$IPF1_Q4_01.
MX M02096 V$IPF1_Q5.
MX M04614 V$IPF1_Q5_01.
MX M01275 V$IPF1_Q6.
XX
BS R15453.
BS R15423.
BS R27393.
BS R27395.
BS R27396.
BS R27397.
BS R27398.
BS R27399.
BS R27400.
BS R27401.
BS R27402.
BS R27403.
BS R27404.
BS R27405.
BS R27406.
BS R27407.
BS R27408.
BS R27409.
BS R27410.
BS R27411.
BS R27412.
BS R27413.
BS R27414.
BS R27415.
BS R27416.
BS R27417.
BS R27418.
BS R27419.
BS R27420.
BS R27421.
BS R27422.
BS R27423.
BS R15419.
BS R15426.
BS R15427.
BS R29135.
BS R29138.
BS R29139.
BS R32699.
BS R38402.
BS R10032.
BS R19509.
BS R15420.
BS R15491.
BS R21222.
BS R24129.
BS R29145.
XX
DR TRANSPATH: MO000083163.
DR EMBL: X74342;
DR UniProtKB: P52946;
XX
RN [1]; RE0005119.
RX PUBMED: 7901001.
RA Ohlsson H., Karlsson K., Edlund T.
RT IPF1, a homeodamain-containing transactivator of the insulin gene
RL EMBO J. 12:4251-4259 (1993).
RN [2]; RE0005120.
RX PUBMED: 7505393.
RA Leonard J., Peers B., Johnson T., Ferreri K., Lee S., Montminy M. R.
RT Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells
RL Mol. Endocrinol. 7:1275-1283 (1993).
RN [3]; RE0005121.
RX PUBMED: 7937976.
RA Petersen H. V., Serup P., Leonhard J., Michelsen B. K., Madsen O. D.
RT Transcriptional regulation of the human insulin gene is dependent on the homeodomain protein STF1/IPF1 acting through the CT boxes
RL Proc. Natl. Acad. Sci. USA 91:10465-10469 (1994).
RN [4]; RE0005122.
RX PUBMED: 7935793.
RA Jonsson J., Carlsson L., Edlund T., Edlund H.
RT Insulin-promoter-factor 1 is required for pancreas development in mice
RL Nature 371:606-609 (1994).
RN [5]; RE0013232.
RX PUBMED: 8799146.
RA Serup P., Jensen J., Andersen F. G., Jorgensen M. C., Blume N., Holst J. J., Madsen O. D.
RT Induction of insulin and islet amyloid polypeptide productions in pancreatic islet glucagonoma cells by insulin promoter factor 1
RL Proc. Natl. Acad. Sci. USA 93:9015-9020 (1996).
RN [6]; RE0016268.
RX PUBMED: 9115263.
RA Carty M. D., Lillquist J. S., Peshavaria M., Stein R., Soeller W. C.
RT Identification of cis- and trans-active factors regulating human islet amyloid polypeptide gene expression in pancreatic beta-cells
RL J. Biol. Chem. 272:11986-11993 (1997).
RN [7]; RE0047888.
RX PUBMED: 15496408.
RA Mosley A. L., Ozcan S.
RT The pancreatic duodenal homeobox-1 protein (Pdx-1) interacts with histone deacetylases Hdac-1 and Hdac-2 on low levels of glucose.
RL J. Biol. Chem. 279:54241-54247 (2004).
RN [8]; RE0048170.
RX PUBMED: 15993959.
RA Aramata S., Han S. I., Yasuda K., Kataoka K.
RT Synergistic activation of the insulin gene promoter by the beta-cell enriched transcription factors MafA, Beta2, and Pdx1.
RL Biochim. Biophys. Acta 1730:41-46 (2005).
RN [9]; RE0048404.
RX PUBMED: 16148004.
RA Iguchi H., Ikeda Y., Okamura M., Tanaka T., Urashima Y., Ohguchi H., Takayasu S., Kojima N., Iwasaki S., Ohashi R., Jiang S., Hasegawa G., Ioka R. X., Magoori K., Sumi K., Maejima T., Uchida A., Naito M., Osborne T. F., Yanagisawa M., Yamamoto T. T., Kodama T., Sakai J.
RT SOX6 attenuates glucose-stimulated insulin secretion by repressing PDX1 transcriptional activity and is down-regulated in hyperinsulinemic obese mice.
RL J. Biol. Chem. 280:37669-37680 (2005).
RN [10]; RE0052072.
RX PUBMED: 14704343.
RA Liberzon A., Ridner G., Walker M. D.
RT Role of intrinsic DNA binding specificity in defining target genes of the mammalian transcription factor PDX1.
RL Nucleic Acids Res. 32:54-64 (2004).
RN [11]; RE0055183.
RX PUBMED: 17052199.
RA An R., da Silva Xavier G., Hao H. X., Semplici F., Rutter J., Rutter G. A.
RT Regulation by Per-Arnt-Sim (PAS) kinase of pancreatic duodenal homeobox-1 nuclear import in pancreatic beta-cells.
RL Biochem. Soc. Trans. 34:791-793 (2006).
RN [12]; RE0055527.
RX PUBMED: 18772243.
RA Boucher M. J., Simoneau M., Edlund H.
RT The homeodomain-interacting protein kinase 2 regulates insulin promoter factor-1/pancreatic duodenal homeobox-1 transcriptional activity.
RL Endocrinology 150:87-97 (2009).
XX
//