TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10594 XX ID T10594 XX DT 05.07.2007 (created); din. DT 04.02.2009 (updated); grs. CO Copyright (C), QIAGEN. XX FA SHP XX SY NR0B2; short heterodimer partner; SHP-1; small heterodimer partner. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002556 NR0B2; HGNC: NR0B2. XX CL C0002; CC (rec). XX SZ 257 AA; 28.1 kDa (cDNA) (calc.). XX SQ MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL SQ DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK SQ ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP SQ GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI SQ IGDVDIAGLLGDMLLLR XX SC Swiss-Prot#Q15466 XX FT 56 227 SM00430; holi. FT 59 252 PF00104; Ligand-binding domain of nuclear hormon. XX IN T08664 C/EBPalpha; Mammalia. IN T34364 G9A; human, Homo sapiens. IN T04106 HDAC1; human, Homo sapiens. IN T08343 HDAC1; human, Homo sapiens. IN T21852 HDAC1; Mammalia. IN T04110 HDAC3; human, Homo sapiens. XX DR TRANSPATH: MO000110129. DR EMBL: L76571; DR UniProtKB: Q15466; XX RN [1]; RE0006318. RX PUBMED: 8650544. RA Seol W., Choi H. S., Moore D. D. RT An orphan nuclear hormone receptor that lacks a DNA binding domain and heterodimerizes with other receptors RL Science 272:1336-1339 (1996). RN [2]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [3]; RE0016409. RX PUBMED: 11030332. RA Goodwin B., Jones S. A., Price R. R., Watson M. A., McKee D. D., Moore L. B., Galardi C., Wilson J. G., Lewis M. C., Roth M. E., Maloney P. R., Willson T. M., Kliewer S. A. RT A regulatory cascade of the nuclear receptors FXR, SHP-1, and LRH-1 represses bile acid biosynthesis RL Mol. Cell 6:517-526 (2000). RN [4]; RE0018060. RX PUBMED: 11574686. RA del Castillo-Olivares A., Gil G. RT Suppression of sterol 12alpha-hydroxylase transcription by the short heterodimer partner: insights into the repression mechanism. RL Nucleic Acids Res. 29:4035-4042 (2001). RN [5]; RE0048535. RX PUBMED: 16282353. RA Oberkofler H., Klein K., Felder T. K., Krempler F., Patsch W. RT Role of peroxisome proliferator-activated receptor-gamma coactivator-1alpha in the transcriptional regulation of the human uncoupling protein 2 gene in INS-1E cells. RL Endocrinology 147:966-976 (2006). RN [6]; RE0051082. RX PUBMED: 17895379. RA Sanyal S., Bavner A., Haroniti A., Nilsson L. M., Lundasen T., Rehnmark S., Witt M. R., Einarsson C., Talianidis I., Gustafsson J. A., Treuter E. RT Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis. RL Proc. Natl. Acad. Sci. USA 104:15665-15670 (2007). RN [7]; RE0053527. RX PUBMED: 17094771. RA Park M. J., Kong H. J., Kim H. Y., Kim H. H., Kim J. H., Cheong J. H. RT Transcriptional repression of the gluconeogenic gene PEPCK by the orphan nuclear receptor SHP through inhibitory interaction with C/EBPalpha. RL Biochem. J. 402:567-574 (2007). RN [8]; RE0055392. RX PUBMED: 15550569. RA Boulias K., Talianidis I. RT Functional role of G9a-induced histone methylation in small heterodimer partner-mediated transcriptional repression. RL Nucleic Acids Res. 32:6096-6103 (2004). XX //