TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09151 XX ID T09151 XX DT 31.07.2006 (created); jag. CO Copyright (C), QIAGEN. XX FA TGIF2-isoform1 XX SY 5'TG3' interacting factor 2; 5'TG3' interacting factor 2; TG-interacting factor 2; TGIF2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006807 TGIF2; HGNC: TGIF2. XX CL C0006; homeo. XX SZ 237 AA; 25.9 kDa (cDNA) (calc.). XX SQ MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNL SQ SVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPA SQ PTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF SQ NTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ XX SC translated from EMBL #AB042646 XX FT 16 79 PS50071; HOMEOBOX_2. FT 18 83 SM00389; HOX_1. FT 19 78 PF00046; Homeobox domain. FT 182 188 putative SH3 binding domain [2]. XX IN T09170 CtBP1-isoform1; human, Homo sapiens. IN T08343 HDAC1; human, Homo sapiens. IN T09538 Smad3; Mammalia. XX MX M01407 V$TGIF2_01. XX DR TRANSPATH: MO000083911. DR EMBL: AB042646; DR UniProtKB: Q9GZN2; XX RN [1]; RE0014544. RX PUBMED: 9336443. RA Burglin T. R. RT Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals RL Nucleic Acids Res. 25:4173-4180 (1997). RN [2]; RE0015497. RX PUBMED: 11006116. RA Imoto I., Pimkhaokham A., Watanabe T., Saito-Ohara F., Soeda E., Inazawa J. RT Amplification and overexpression of TGIF2, a novel homeobox gene of the TALE superclass, in ovarian cancer cell lines RL Biochem. Biophys. Res. Commun. 276:264-270 (2000). RN [3]; RE0047925. RX PUBMED: 11427533. RA Melhuish T. A., Gallo C. M., Wotton D. RT TGIF2 interacts with histone deacetylase 1 and represses transcription. RL J. Biol. Chem. 276:32109-32114 (2001). XX //