TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09170 XX ID T09170 XX DT 01.08.2006 (created); jag. DT 04.09.2014 (updated); pos. CO Copyright (C), QIAGEN. XX FA CtBP1-isoform1 XX SY C-terminal binding protein; C-terminal binding protein 1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004732 CTBP1; HGNC: CTBP1. XX SZ 440 AA; 47.5 kDa (cDNA) (calc.). XX SQ MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ SQ EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV SQ PAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGII SQ GLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLN SQ EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS SQ QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT SQ HWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA SQ PSPGQTVKPEADRDHASDQL XX SC translated from EMBL #U37408 XX FT 29 122 PF00389; D-isomer specific 2-hydroxyacid dehydrog. FT 88 371 PF00478; IMP dehydrogenase / GMP reductase domain. FT 133 313 PF02826; D-isomer specific 2-hydroxyacid dehydrog. XX IN T05220 Evi-1; human, Homo sapiens. IN T25625 hdac2; human, Homo sapiens. IN T15475 Ikaros-1; Mammalia. IN T01469 Ikaros-isoform1; mouse, Mus musculus. IN T09490 Ikaros-isoform1; human, Homo sapiens. IN T01470 Ikaros-isoform2; mouse, Mus musculus. IN T01471 Ikaros-isoform3; mouse, Mus musculus. IN T00479 Ikaros; mouse, Mus musculus. IN T14622 sin3a; human, Homo sapiens. IN T10218 TGIF1-isoform1; mouse, Mus musculus. IN T09151 TGIF2-isoform1; human, Homo sapiens. IN T04076 TGIF; human, Homo sapiens. XX BS R63390. BS R63603. BS R63635. XX DR TRANSPATH: MO000084023. DR EMBL: AF091555; AF091555. DR EMBL: BC011655; BC011655. DR EMBL: U37408; HS37408. DR UniProtKB: Q13363; CTB1_HUMAN. XX RN [1]; RE0026561. RX PUBMED: 10766745. RA Koipally J., Georgopoulos K. RT Ikaros interactions with CtBP reveal a repression mechanism that is independent of histone deacetylase activity RL J. Biol. Chem. 275:19594-602 (2000). RN [2]; RE0027320. RX PUBMED: 10995736. RA Melhuish T. A., Wotton D. RT The interaction of the carboxyl terminus-binding protein with the smad corepressor TGIF is disrupted by a holoprosencephaly mutation in TGIF RL J. Biol. Chem. 275:39762-6 (2000). RN [3]; RE0047925. RX PUBMED: 11427533. RA Melhuish T. A., Gallo C. M., Wotton D. RT TGIF2 interacts with histone deacetylase 1 and represses transcription. RL J. Biol. Chem. 276:32109-32114 (2001). XX //