TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10218 XX ID T10218 XX DT 06.02.2007 (created); sou. DT 12.05.2014 (updated); mkl. CO Copyright (C), QIAGEN. XX FA TGIF1-isoform1 XX SY 5'-TG-3' interacting factor; 5'TG3' interacting factor; TG-interacting factor. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002126 Tgif1. XX CL C0006; homeo; 3.1.4.6.1.2. XX SZ 272 AA; 29.6 kDa (cDNA) (calc.). XX SQ MKSKKGLVAASGSDSEDEDSMDSPLDLSSSAASGMRRRRGNLPKESVQILRDWLYEHRYN SQ AYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEA SQ SSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTA SQ LKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTP SQ PDLNQDFSGFQLLVDVALKRAAEMELQAKLTA XX SC translated from EMBL #X89749 XX FT 33 96 PS50071; HOMEOBOX_2. FT 35 100 SM00389; HOX_1. FT 36 95 PF00046; Homeobox domain. FT 235 241 putative SH3 binding domain [2]. XX IN T09170 CtBP1-isoform1; human, Homo sapiens. IN T14622 sin3a; human, Homo sapiens. XX MX M00418 V$TGIF_01. MX M01346 V$TGIF_02. XX DR TRANSPATH: MO000098385. DR EMBL: X89749; DR UniProtKB: P70284-1; IF1_MOUSE. XX RN [1]; RE0014544. RX PUBMED: 9336443. RA Burglin T. R. RT Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals RL Nucleic Acids Res. 25:4173-4180 (1997). RN [2]; RE0015475. RX PUBMED: 8901052. RA Bertolino E., Wildt S., Richards G., Clerc R. G. RT Expression of a novel murine homeobox gene in the developing cerebellar external granular layer during its proliferation RL Dev. Dyn. 205:410-420 (1996). RN [3]; RE0027320. RX PUBMED: 10995736. RA Melhuish T. A., Wotton D. RT The interaction of the carboxyl terminus-binding protein with the smad corepressor TGIF is disrupted by a holoprosencephaly mutation in TGIF RL J. Biol. Chem. 275:39762-6 (2000). RN [4]; RE0029026. RX PUBMED: 11682623. RA Sharma M., Sun Z. RT 5'TG3' interacting factor interacts with Sin3A and represses AR-mediated transcription. RL Mol. Endocrinol. 15:1918-28 (2001). RN [5]; RE0041634. RX PUBMED: 11571228. RA Wotton D., Knoepfler P. S., Laherty C. D., Eisenman R. N., Massague J. RT The Smad transcriptional corepressor TGIF recruits mSin3 RL Cell Growth Differ. 12:457-63 (2001). XX //