TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09156 XX ID T09156 XX DT 31.07.2006 (created); jag. DT 08.03.2007 (updated); sou. CO Copyright (C), QIAGEN. XX FA TGIF-isoform2 XX SY 5'-TG-3' interacting factor; 5'TG3' interacting factor; TG-interacting factor; TGIF1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002125 TGIF1; HGNC: TGIF1. XX CL C0006; homeo; 3.1.4.6.1.2. XX SZ 272 AA; 29.7 kDa (cDNA) (calc.). XX SQ MKGKKGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYN SQ AYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISET SQ SSVESVMGIKNFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTA SQ LKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTP SQ PDLNQDFSGFQLLVDVALKRAAEMELQAKLTA XX SC translated from EMBL #X89750 XX FT 1 63 repression domain [6]. FT 33 96 PS50071; HOMEOBOX_2. FT 35 100 SM00389; HOX_1. FT 36 95 PF00046; Homeobox domain. FT 108 192 HDAC1T04106 interaction domain [5]. FT 138 192 Smad T04095 interaction domain (SID) [6]. FT 192 272 repression domain [6]. FT 235 235 MAP kinase phosphorylation site (T235) [8]. FT 235 241 putative SH3 binding domain [3]. FT 239 239 MAP kinase phosphorylation site (T239) [8]. XX IN T08487 AR-isoform1; human, Homo sapiens. IN T14622 sin3a; human, Homo sapiens. XX MX M00418 V$TGIF_01. MX M01346 V$TGIF_02. XX BS R09609. BS R09610. BS R09611. BS R09612. BS R09613. BS R09614. BS R09615. BS R09616. BS R09617. BS R09618. BS R09619. BS R09620. BS R09621. BS R09622. BS R09623. BS R09633. BS R03931. XX DR TRANSPATH: MO000083920. DR EMBL: AF179900; DR EMBL: X89750; DR UniProtKB: Q15583-2; XX RN [1]; RE0014544. RX PUBMED: 9336443. RA Burglin T. R. RT Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals RL Nucleic Acids Res. 25:4173-4180 (1997). RN [2]; RE0015443. RX PUBMED: 10835638. RA Gripp K. W., Wotton D., Edwards M. C., Roessler E., Ades L., Meinecke P., Richieri-Costa A., Zackai E. H., Massague J., Muenke M., Elledge S. J. RT Mutations in TGIF cause holoprosencephaly and link NODAL signalling to human neural axis determination RL Nat. Genet. 25:205-208 (2000). RN [3]; RE0015444. RX PUBMED: 8537382. RA Bertolino E., Reimund B., Wildt-Perinic D., Clerc R. G. RT A novel homeobox protein which recognizes a TGT core and functionally interferes with a retinoid-responsive motif RL J. Biol. Chem. 270:31178-31188 (1995). RN [4]; RE0015454. RX PUBMED: 9383053. RA Edwards M. C., Liegeois N., Horecka J., DePinho R. A., Sprague GF J. r., Tyers M., Elledge S. J. RT Human CPR (cell cycle progression restoration) genes impart a Far- phenotype on yeast cells RL Genetics 147:1063-1076 (1997). RN [5]; RE0015455. RX PUBMED: 10601270. RA Wotton D., Lo R. S., Swaby L. A., Massague J. RT Multiple modes of repression by the Smad transcriptional corepressor TGIF RL J. Biol. Chem. 274:37105-37110 (1999). RN [6]; RE0015456. RX PUBMED: 10199400. RA Wotton D., Lo R. S., Lee S., Massague J. RT A Smad transcriptional corepressor RL Cell 97:29-39 (1999). RN [7]; RE0015476. RX PUBMED: 10764806. RA Yang Y., Hwang C. K., D'Souza U. M., Lee S. H., Junn E., Mouradian M. M. RT Three-amino acid extension loop homeodomain proteins Meis2 and TGIF differentially regulate transcription RL J. Biol. Chem. 275:20734-20741 (2000). RN [8]; RE0016125. RX PUBMED: 11226163. RA Lo R. S., Wotton D., Massague J. RT Epidermal growth factor signaling via Ras controls the Smad transcriptional co-repressor TGIF RL EMBO J. 20:128-136 (2001). RN [9]; RE0029026. RX PUBMED: 11682623. RA Sharma M., Sun Z. RT 5'TG3' interacting factor interacts with Sin3A and represses AR-mediated transcription. RL Mol. Endocrinol. 15:1918-28 (2001). RN [10]; RE0047925. RX PUBMED: 11427533. RA Melhuish T. A., Gallo C. M., Wotton D. RT TGIF2 interacts with histone deacetylase 1 and represses transcription. RL J. Biol. Chem. 276:32109-32114 (2001). XX //