TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09961 XX ID T09961 XX DT 29.11.2006 (created); din. DT 29.11.2006 (updated); din. CO Copyright (C), QIAGEN. XX FA TFIIF-alpha XX SY GTF2F1; RAP74; TFIIF-alpha; transcription initiation factor IIF, alpha subunit. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006186 GTF2F1; HGNC: GTF2F1. XX SZ 517 AA; 58.3 kDa (cDNA) (calc.), 78 kDa, 80 kDa (SDS) [8] [7] XX SQ MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEE SQ EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE SQ NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR SQ RLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL SQ AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKG SQ VDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSA SQ FFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA SQ KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK SQ KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE XX SC Swiss-Prot#P35269 XX FT 1 120 binding to TAF(II)250 [1]. FT 1 170 suggested globular domain [6]. FT 1 517 PF05793; Transcription initiation factor IIF, alph. FT 62 171 interaction wih TFIIF-beta [10]. FT 357 517 suggested globular domain, essential for full activity [6]. FT 357 517 suggested globular domain, essential for full activity [10]. XX IN T08487 AR-isoform1; human, Homo sapiens. XX DR TRANSPATH: MO000093589. DR EMBL: X64002; DR EMBL: X64037; DR UniProtKB: P35269; XX RN [1]; RE0005590. RX PUBMED: 7590250. RA Ruppert S., Tjian R. RT Human TAFII250 interacts with RAP74: implications for RNA polymerase II initiation RL Genes Dev. 9:2747-2755 (1995). RN [2]; RE0005736. RX PUBMED: 8106390. RA Zhu H., Joliot V., Prywes R. RT Role of transcription factor TRIIF in serum response factor-activated transcription RL J. Biol. Chem. 269:3489-3497 (1994). RN [3]; RE0005737. RX PUBMED: 7961996. RA Kitajima S., Chibazakura T., Yonaha M., Yasukochi Y. RT Regulation of the human general transcription initiation factor TFIIF by phosphorylation RL J. Biol. Chem. 269:29970-29977 (1994). RN [4]; RE0005739. RX PUBMED: 7854423. RA Joliot V., Demma M., Prywes R. RT Interaction with RAP74 subunit of TFIIF is required for transcriptional activation by serum response factor RL Nature 373:632-635 (1995). RN [5]; RE0005740. RX PUBMED: 1734283. RA Aso T., Vasavada H. A., Kawaguchi T., Germino F. J., Ganguly S., Kitajima S., Weissman S. M., Yasukochi Y. RT Characterization of cDNA for the large subunit of the transcription initiation factor TFIIF RL Nature 335:461-464 (1992). RN [6]; RE0005741. RX PUBMED: 1734284. RA Finkelstein A., Kostrub C. F., Li J., Chavez D. P., Wang B. Q., Fang S. M., Greenblatt J., Burton Z. F. RT A cDNA encoding RAP74, a general initiation factor for transcription by RNA polymerase II RL Nature 355:464-467 (1992). RN [7]; RE0005750. RX PUBMED: 2180931. RA Flores O., Ha I., Reinberg D. RT Factors involved in specific transcription by mammalian RNA polymerase II. Purification and subunit composition of transcription factor IIE RL J. Biol. Chem. 265:5629-5634 (1990). RN [8]; RE0005751. RX PUBMED: 2395645. RA Kitajima S., Tanaka Y., Kawagachi T., Nagaoka T., Weissman S. M., Yasukochi Y. RT A heteromeric transcription factor required for mammalian RNA polymerase II RL Nucleic Acids Res. 18:4843-4849 (1990). RN [9]; RE0005753. RX PUBMED: 8376403. RA Chang C.-H., Kostrub C. F., Burton Z. F. RT RAP30/74 (transcription factor IIF) is required for promoter escape by RNA polymerase II RL J. Biol. Chem. 268:20482-20489 (1993). RN [10]; RE0005754. RX PUBMED: 8441635. RA Yonaha M., Aso T., Kobayashi Y., Vasavada H., Yasukochi Y., Weissman S. M., Kitajima S. RT Domain structure of a human general transcription initiation factor, TFIIF RL Nucleic Acids Res. 21:273-279 (1993). RN [11]; RE0029221. RX PUBMED: 9238003. RA McEwan I. J., Gustafsson J. RT Interaction of the human androgen receptor transactivation function with the general transcription factor TFIIF. RL Proc. Natl. Acad. Sci. USA 94:8485-90 (1997). XX //