TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08445 XX ID T08445 XX DT 20.01.2006 (created); jag. DT 16.05.2014 (updated); ili. CO Copyright (C), QIAGEN. XX FA Elk1-isoform1 XX SY Elk-1; Elk1-1; p62TCF; TCF-A. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003924 ELK1; HGNC: Elk1. XX CL C0016; ETS; 3.5.2.2.1.1. XX SZ 428 AA; 44.9 kDa (gene) (calc.), 58 kDa (SDS) [13] XX SQ MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL SQ SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH SQ AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV SQ LPNAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL SQ GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH SQ AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH SQ TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV SQ LSPGPQKP XX SC translated from EMBL:M25269 XX FT 1 88 interactions with C/EBPbeta [10]. FT 4 88 PF00178; Ets-domain. FT 4 90 SM00413; etsneu2. FT 5 86 PS50061; ETS_DOMAIN_3. FT 7 76 PS50140; HSF_ETS. FT 137 169 essential for ternary complex formation with SRF [11]. FT 137 169 essential for ternary complex formation with SRF [8]. FT 148 168 Box B, interactions with SRF [6]. FT 148 168 Box B, interactions with SRF [11]. FT 307 428 regulated trans-activation domain [9]. FT 307 428 regulated trans-activation domain [12]. FT 324 324 serine-phosphorylation by MAP kinase(-like) activity (ERK1, ERK2) [7]. FT 336 336 threonine-phosphorylation by MAP kinase(-like) activity (ERK1, ERK2) [7]. FT 383 383 serine-phosphorylation by MAP kinase(-like) activity (ERK1, ERK2) [7]. FT 389 389 serine-phosphorylation by MAP kinase(-like) activity (ERK1, ERK2) [7]. FT 422 422 serine-phosphorylation by MAP kinase(-like) activity (ERK1, ERK2) [7]. XX IN T08487 AR-isoform1; human, Homo sapiens. IN T08499 CBP; mouse, Mus musculus. IN T21852 HDAC1; Mammalia. XX MX M00007 V$ELK1_01. MX M00025 V$ELK1_02. MX M02059 V$ELK1_06. MX M07252 V$ELK1_Q4. MX M03819 V$ELK1_Q6. MX M00771 V$ETS_Q4. MX M00971 V$ETS_Q6. XX BS R00040. BS R14965. BS R00460. BS R00466. BS R15110. BS R15111. BS R14623. BS R14624. BS R14625. BS R16113. BS R15105. BS R01155. XX DR TRANSPATH: MO000057927. DR EMBL: M25269; HSELK1A. DR UniProtKB: P19419-1; XX RN [1]; RE0028344. RX PUBMED: 11083868. RA Nissen L. J., Gelly J. C., Hipskind R. A. RT Induction-independent recruitment of CREB-binding protein to the c-fos serum response element through interactions between the bromodomain and Elk-1. RL J. Biol. Chem. 276:5213-21 (2001). RN [2]; RE0047963. RX PUBMED: 11134340. RA Roberts E. C., Deed R. W., Inoue T., Norton J. D., Sharrocks A. D. RT Id helix-loop-helix proteins antagonize pax transcription factor activity by inhibiting DNA binding. RL Mol. Cell. Biol. 21:524-533 (2001). RN [3]; RE0048074. RX PUBMED: 11283259. RA Yang S. H., Vickers E., Brehm A., Kouzarides T., Sharrocks A. D. RT Temporal recruitment of the mSin3A-histone deacetylase corepressor complex to the ETS domain transcription factor Elk-1. RL Mol. Cell. Biol. 21:2802-2814 (2001). RN [4]; RE0048801. RX PUBMED: 15210726. RA Salinas S., Briancon-Marjollet A., Bossis G., Lopez M. A., Piechaczyk M., Jariel-Encontre I., Debant A., Hipskind R. A. RT SUMOylation regulates nucleo-cytoplasmic shuttling of Elk-1. RL J. Cell Biol. 165:767-773 (2004). RN [5]; RE0065087. RX PUBMED: 17652082. RA Patel D. N., King C. A., Bailey S. R., Holt J. W., Venkatachalam K., Agrawal A., Valente A. J., Chandrasekar B. RT Interleukin-17 stimulates C-reactive protein expression in hepatocytes and smooth muscle cells via p38 MAPK and ERK1/2-dependent NF-kappaB and C/EBPbeta activation. RL J. Biol. Chem. 282:27229-27238 (2007). RN [6]; RE0015343. RX PUBMED: 9171356. RA Ling Y., Lakey J. H., Roberts C. E., Sharrocks A.D. RT Molecular characterization of the B-box protein-protein interaction motif of the ETS-domain transcription factor Elk-1 RL EMBO J. 16:2431-2440 (1997). RN [7]; RE0005333. RX PUBMED: 7889942. RA Gille H., Kortenjann M., Thomae O., Moomaw C., Slaughter C., Cobb M. H., Shaw P. E. RT ERK phosphorylation potentiates Elk-1-mediated ternary complex formation and transactivation RL EMBO J. 14:951-962 (1995). RN [8]; RE0005372. RX PUBMED: 1630903. RA Janknecht R., Nordheim A. RT Elk-1 protein domains required for direct and SRF-assisted DNA-binding RL Nucleic Acids Res. 20:3317-3324 (1992). RN [9]; RE0000280. RX PUBMED: 8386592. RA Marais R., Wynne J., Treisman R. RT The SRF accessory protein Elk-1 contains a growth factor-regulated transcriptional activation domain RL Cell 73:381-393 (1993). RN [10]; RE0016725. RX PUBMED: 11151091. RA Hanlon M., Bundy L. M., Sealy L. RT C/EBPBeta and Elk-1 synergistically transactivate the c-fos serum response element. RL BMC Cell Biol. 1:2 (2000). RN [11]; RE0005331. RX PUBMED: 8164681. RA Shore P., Sharrocks A. D. RT The transcriptional factors Elk-1 and serum response factor interact by direct protein-protein contacts mediated by a short region of Elk-1 RL Mol. Cell. Biol. 14:3283-3291 (1994). RN [12]; RE0005335. RX PUBMED: 8477450. RA Hill C. S., Marais R., John S., Wynne J., Dalton S., Treisman R. RT Functional analysis of a growth factor-responsive transcription factor complex RL Cell 73:395-406 (1993). RN [13]; RE0005334. RX PUBMED: 2539641. RA Rao V. N., Huebner K., Isobe M., Ar-rushdi A., Croce C. M., Reddy E. S. RT elk, tissue-specific ets-related genes on chromosomes X and 14 near translocation breakpoints RL Science 244:66-70 (1989). XX //