![TRANSFAC-Logo](/transfac_factor/images/logo_genexplain.png)
AC T09323
XX
ID T09323
XX
DT 19.09.2006 (created); man.
DT 08.10.2014 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA IRF-1
XX
SY IRF1; Interferon regulatory factor 1; IRF-1; IRF1; ISGF2.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G000324 IRF1; HGNC: IRF1.
XX
CL C0022; trp.
XX
SZ 325 AA; 36.5 kDa (cDNA) (calc.), 37 kDa (SDS)
XX
SQ MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
SQ HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
SQ KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT
SQ PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL
SQ LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
SQ MDATWLDSLLTPVRLPSIQAIPCAP
XX
SC Swiss-Prot#P10914
XX
FT 1 114
SM00348; IRF.
FT 6 114
PF00605; Interferon regulatory factor transcription f.
FT 200 262
IAD2, IRF association domain 2 [18].
XX
IN T06148 p/CAF; human, Homo sapiens.
IN T10397 RelA-p65; Mammalia.
XX
MX M00062 V$IRF1_01.
MX M07045 V$IRF1_Q5.
MX M00747 V$IRF1_Q6.
MX M08887 V$IRF_Q4.
MX M00772 V$IRF_Q6.
MX M00972 V$IRF_Q6_01.
XX
BS R22255.
BS R37589.
BS R22214.
BS R37591.
BS R13380.
BS R26941.
BS R13141.
BS R30687.
BS R26850.
BS R00950.
BS R00915.
BS R00919.
BS R00927.
BS R14452.
BS R14454.
BS R14492.
BS R00949.
BS R14802.
BS R28294.
BS R19537.
BS R12710.
BS R37595.
BS R22184.
BS R14440.
BS R22253.
BS R24506.
XX
DR TRANSPATH: MO000087457.
DR EMBL: L05072;
DR EMBL: X14454;
DR UniProtKB: P10914;
XX
RN [1]; RE0000099.
RX PUBMED: 3409321.
RA Miyamoto M., Fujita T., Kimura Y., Maruyama M., Harada H., Sudo Y., Miyata T., Taniguchi T.
RT Regulated Expression of a Gene Encoding a Nuclear Factor, IRF-1, That Specifically Binds to IFN-beta Gene Regulatory Elements
RL Cell 54:903-913 (1988).
RN [2]; RE0000687.
RX PUBMED: 1851123.
RA Keller A. D., Maniatis T.
RT Identification and characterization of a novel repressor of beta-interferon gene expression
RL Genes Dev. 5:868-879 (1991).
RN [3]; RE0001377.
RX PUBMED: 2796995.
RA Pine R., Darnell J. E.
RT In Vivo Evidence of Interaction between Interferon-Stimulated Gene Factors and the Interferon-Stimulated Response Element
RL Mol. Cell. Biol. 9:3533-3537 (1989).
RN [4]; RE0001438.
RX PUBMED: 2342456.
RA Pine R., Decker T., Kessler D. S., Levy D. E., Darnell J. E.
RT Purification and Cloning of Interferon-Stimulated Gene Factor 2 (ISGF2): ISGF2 (IRF-1) Can Bind to the Promoters of Both Beta Interferon- and Interferon-Stimulated Genes but Is Not a Primary Transcriptional Activator of Either
RL Mol. Cell. Biol. 10:2448-2457 (1990).
RN [5]; RE0002006.
RX PUBMED: 2726484.
RA Reich N. C., Darnell jr J. E.
RT Differential binding of interferon-induced factors to an oligonucleotide that mediates transcriptional activation
RL Nucleic Acids Res. 17:3415-3424 (1989).
RN [6]; RE0002092.
RX PUBMED: 2123539.
RA Imam A. M. A., Ackrill A. M., Dale T. C., Kerr I. M., Stark G. R.
RT Transcription factors induced by interferons alpha and gamma
RL Nucleic Acids Res. 18:6573-6580 (1990).
RN [7]; RE0002322.
RX PUBMED: 2460869.
RA Kessler D. S., Levy D. E., Darnell jr J. E.
RT Two interferon-induced nuclear factors bind a single promoter element in interferon-stimulated genes
RL Proc. Natl. Acad. Sci. USA 85:8521-8525 (1988).
RN [8]; RE0002927.
RX PUBMED: 8168491.
RA Harroch S., Revel M., Chebath J.
RT Induction by interleukin-6 of interferon regulatory factor 1 (IRF-1) gene expression through the palindromic interferon response element pIRE and cell type-dependent control of IRF-1 binding to DNA
RL EMBO J. 13:1942-1949 (1994).
RN [9]; RE0002930.
RX PUBMED: 7687740.
RA Tanaka N., Kawakami T., Taniguchi T.
RT Recognition DNA sequences of interferon regulatory factor 1 (IRF-1) and IRF-2, regulators of cell growth and the interferon system
RL Mol. Cell. Biol. 13:4531-4538 (1993).
RN [10]; RE0003466.
RX PUBMED: 1371248.
RA Reis L. F. L., Harada H., Wolchok J. D., Taniguchi T., Vilcek J.
RT Critical role of a common transcription factor, IRF-1, in the regulation of IFN-beta and IFN-inducible genes
RL EMBO J. 11:185-193 (1992).
RN [11]; RE0003467.
RX PUBMED: 7678055.
RA Sims S. H., Cha Y., Romine M. F., Gao P., Gottlieb K., Deisseroth A. B.
RT A novel interferon-inducible domain: structural and functional analysis of the human interferon regulatory factor 1 gene promoter
RL Mol. Cell. Biol. 13:690-702 (1993).
RN [12]; RE0003468.
RX PUBMED: 8306959.
RA Pine R., Canova A., Schindler C.
RT Tyrosine phosphorylated p91 binds to a single element in the ISGF2/IRF-1 promoter to mediate induction by IFNalpha and IFNgamma, and is likely to autoregulate the p91 gene
RL EMBO J. 13:158-167 (1994).
RN [13]; RE0003469.
RX PUBMED: 8197182.
RA Bovolenta C., Driggers P. H., Marks M. S., Medin J. A., Politis A. D., Vogel S. N., Levy D. E., Sakaguchi K., Appella E., Coligan J. E., Ozato K.
RT Molecular interactions between interferon consensus sequence binding protein and members of the interferon regulatory factor family
RL Proc. Natl. Acad. Sci. USA 91:5046-5050 (1994).
RN [14]; RE0003470.
RX PUBMED: 8438157.
RA Harada H., Kitagawa M., Tanaka N., Yamamoto H., Harada K., Ishihara M., Taniguchi T.
RT Anti-oncogenic and oncogenic potentials of interferon regulatory factors-1 and -2
RL Science 259:971-974 (1993).
RN [15]; RE0003471.
RX PUBMED: 2726461.
RA Maruyama M., Fujita T., Taniguchi T.
RT Sequence of a cDNA coding for human IRF-1
RL Nucleic Acids Res. 17:3292-3292 (1989).
RN [16]; RE0003472.
RX PUBMED: 8438156.
RA Willman C. L., Sever C., Pallavicini M. G., Harada H., Tanaka N., Slovak M. L., Yamamoto H., Harada K., Meeker T. C., List A. F., Taniguchi T.
RT Deletion of IRF-1, mapping to chromosome 5q31.1, in human leukemia and preleukemic myelodysplasia
RL Science 259:968-971 (1993).
RN [17]; RE0003473.
RX PUBMED: 7507207.
RA Harada H., Takahashi E.-I., Itoh S., Harada K., Hori T.-A., Taniguchi T.
RT Structure and regulation of the human interferon regulatory factor 1 (IRF-1) and IRF-2 genes: implications for a gene network in the interferon system
RL Mol. Cell. Biol. 14:1500-1509 (1994).
RN [18]; RE0017830.
RX PUBMED: 10586038.
RA Meraro D., Hashmueli S., Koren B., Azriel A., Oumard A., Kirchhoff S., Hauser H., Nagulapalli S., Atchison M. L., Levi B.- Z.
RT Protein-protein and DNA-protein interactions affect the activity of lymphoid-specific IFN regulatory factors.
RL J. Immunol. 163:6468-6478 (1999).
RN [19]; RE0019561.
RX PUBMED: 1382447.
RA CHA Y., SIMS S.H., ROMINE M.F., KAUFMANN M., DEISSEROTH A.B.
RT Human interferon regulatory factor 1: intron-exon organization.
RL DNA Cell Biol. 11:605-611 (1992).
RN [20]; RE0023149.
RX PUBMED: 11781315.
RA Kumatori A., Yang D., Suzuki S., Nakamura M.
RT Cooperation of STAT-1 and IRF-1 in interferon-gamma-induced transcription of the gp91(phox) gene.
RL J. Biol. Chem. 277:9103-9111 (2002).
RN [21]; RE0048289.
RX PUBMED: 10022868.
RA Masumi A., Wang I. M., Lefebvre B., Yang X. J., Nakatani Y., Ozato K.
RT The histone acetylase PCAF is a phorbol-ester-inducible coactivator of the IRF family that confers enhanced interferon responsiveness.
RL Mol. Cell. Biol. 19:1810-1820 (1999).
RN [22]; RE0055495.
RX PUBMED: 16172134.
RA Yoshida K., Yamamoto K., Kohno T., Hironaka N., Yasui K., Kojima C., Mukae H., Kadota J., Suzuki S., Honma K., Kohno S., Matsuyama T.
RT Active repression of IFN regulatory factor-1-mediated transactivation by IFN regulatory factor-4.
RL Int. Immunol. 17:1463-1471 (2005).
RN [23]; RE0055827.
RX PUBMED: 12835654.
RA Tasheva E. S., Conrad G. W.
RT Interferon-gamma regulation of the human mimecan promoter.
RL Mol. Vis. 9:277-287 (2003).
RN [24]; RE0066125.
RX PUBMED: 17785777.
RA Osterlund P. I., Pietila T. E., Veckman V., Kotenko S. V., Julkunen I.
RT IFN regulatory factor family members differentially regulate the expression of type III IFN (IFN-lambda) genes.
RL J. Immunol. 179:3434-3442 (2007).
RN [25]; RE0068264.
RX PUBMED: 18955028.
RA Kim E. J., Park J. S., Um S. J.
RT Ubc9-mediated sumoylation leads to transcriptional repression of IRF-1.
RL Biochem. Biophys. Res. Commun. 377:952-956 (2008).
RN [26]; RE0068472.
RX PUBMED: 10094406.
RA Lin R., Hiscott J.
RT A role for casein kinase II phosphorylation in the regulation of IRF-1 transcriptional activity.
RL Mol. Cell. Biochem. 191:169-180 (1999).
XX
//