TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09325 XX ID T09325 XX DT 19.09.2006 (created); man. DT 11.02.2011 (updated); jtr. CO Copyright (C), QIAGEN. XX FA IRF-2 XX SY INTERFERON REGULATORY FACTOR 2; IRF-2; IRF2; PRDI-BFc; PRDI-BFi. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001059 Irf2. XX CL C0022; trp. XX SZ 349 AA; 39.4 kDa (cDNA) (calc.). XX SQ MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI SQ HTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNNAFRVYRMLPLSERPSK SQ KGKKPKTEKEERVKHIKQEPVESSLGLSNGVSGFSPEYAVLTSAIKNEVDSTVNIIVVGQ SQ SHLDSNIEDQEIVTNPPDICQVVEVTTESDDQPVSMSELYPLQISPVSSYAESETTDSVA SQ SDEENAEGRPHWRKRSIEGKQYLSNMGTRNTYLLPSMATFVTSNKPDLQVTIKEDSCPMP SQ YNSSWPPFTDLPLPAPVTPTPSSSRPDRETRASVIKKTSDITQARVKSC XX SC Swiss-Prot#P23906 XX FT 1 114 SM00348; IRF. FT 5 114 PF00605; Interferon regulatory factor transcription f. FT 8 17 alpha-helix 1 [13]. FT 25 28 beta-strand 1 [13]. FT 33 37 beta-strand 2 [13]. FT 48 61 alpha-helix 2 [13]. FT 74 87 alpha helix 3 [13]. FT 91 94 beta-strand 3 [13]. FT 106 111 beta-strand 4 [13]. FT 210 267 IAD2, IRF association domain 2 [10]. XX SF overall structure model of the IRF2-DNA complex has been created [13]; XX IN T06148 p/CAF; human, Homo sapiens. XX MX M01882 V$IRF2_Q6. MX M08887 V$IRF_Q4. MX M00772 V$IRF_Q6. MX M00972 V$IRF_Q6_01. XX BS R22175. BS R22210. BS R14492. BS R34369. BS R13576. BS R34368. XX DR TRANSPATH: MO000087463. DR EMBL: J03168; DR UniProtKB: P23906; DR PDB: 1IRF. DR PDB: 1IRG. XX RN [1]; RE0000097. RX PUBMED: 2475256. RA Harada H., Fujita T., Miyamoto M., Kimura Y., Maruyama M., Furia A., Miyata T., Taniguchi T. RT Structurally similar but functionally distinct factors, IRF-1 and IRF-2, bind to the same regulatory elements of IFN and IFN-inducible genes RL Cell 58:729-739 (1989). RN [2]; RE0000171. RX PUBMED: 2208287. RA Harada H., Willison K., Sakakibara J., Miyamoto M., Fujita T., Taniguchi T. RT Absence of the type I IFN system in EC cells: transcriptional activator (ITF-1) and repressor (IRF-2) genes are developmentally regulated RL Cell 63:303-312 (1990). RN [3]; RE0001630. RX PUBMED: 2038316. RA Pleiman C. M., Gimpel S. D., Park L. S., Harada H., Taniguchi T., Ziegler S. F. RT Organization of the murine and human interleukin-7 receptor genes: two mRNAs generated by differential splicing and presence of a type I-interferon-inducible promoter RL Mol. Cell. Biol. 11:3052-3059 (1991). RN [4]; RE0002174. RX PUBMED: 1886766. RA Watanabe N., Sakakibara J., Hovanessian A. G., Taniguchi T., Fujita T. RT Activation of IFN-beta element by IRF-1 requires a post-translational event in addition to IRF-1 synthesis RL Nucleic Acids Res. 19:4421-4428 (1991). RN [5]; RE0002930. RX PUBMED: 7687740. RA Tanaka N., Kawakami T., Taniguchi T. RT Recognition DNA sequences of interferon regulatory factor 1 (IRF-1) and IRF-2, regulators of cell growth and the interferon system RL Mol. Cell. Biol. 13:4531-4538 (1993). RN [6]; RE0003461. RX PUBMED: 8402903. RA Matsuyama T., Kimura T., Kitagawa M., Pfeffer K., Kawakami T., Watanabe N., Kuendig T. M., Amakawa R., Kishihara K., Wakeham A., Potter J., Furlonger C. L., Narendran A., Suzuki H., Ohashi P. S., Paige C. J., Taniguchi T., Mak T. W. RT Targeted disruption of IRF-1 or IRF-2 results in abnormal type I IFN gene induction and aberrant lymphocyte developement RL Cell 75:83-97 (1993). RN [7]; RE0003469. RX PUBMED: 8197182. RA Bovolenta C., Driggers P. H., Marks M. S., Medin J. A., Politis A. D., Vogel S. N., Levy D. E., Sakaguchi K., Appella E., Coligan J. E., Ozato K. RT Molecular interactions between interferon consensus sequence binding protein and members of the interferon regulatory factor family RL Proc. Natl. Acad. Sci. USA 91:5046-5050 (1994). RN [8]; RE0003470. RX PUBMED: 8438157. RA Harada H., Kitagawa M., Tanaka N., Yamamoto H., Harada K., Ishihara M., Taniguchi T. RT Anti-oncogenic and oncogenic potentials of interferon regulatory factors-1 and -2 RL Science 259:971-974 (1993). RN [9]; RE0013380. RX PUBMED: 9562558. RA Furui J., Uegaki K., Yamazaki T., Shirakawa M., Swindells M. B., Harada H., Taniguchi T., Kyogoku Y. RT Solution structure of the IRF-2 DNA-binding domain: a novel subgroup of the winged helix-turn-helix family RL Structure 6:491-500 (1998). RN [10]; RE0017830. RX PUBMED: 10586038. RA Meraro D., Hashmueli S., Koren B., Azriel A., Oumard A., Kirchhoff S., Hauser H., Nagulapalli S., Atchison M. L., Levi B.- Z. RT Protein-protein and DNA-protein interactions affect the activity of lymphoid-specific IFN regulatory factors. RL J. Immunol. 163:6468-6478 (1999). RN [11]; RE0017930. RX PUBMED: 10415056. RA Salkowski C. A., Kopydlowski K., Blanco J., Cody M. J., McNally R., Vogel S. N. RT IL-12 is dysregulated in macrophages from IRF-1 and IRF-2 knockout mice. RL J. Immunol. 163:1529-1536 (1999). RN [12]; RE0048289. RX PUBMED: 10022868. RA Masumi A., Wang I. M., Lefebvre B., Yang X. J., Nakatani Y., Ozato K. RT The histone acetylase PCAF is a phorbol-ester-inducible coactivator of the IRF family that confers enhanced interferon responsiveness. RL Mol. Cell. Biol. 19:1810-1820 (1999). RN [13]; RE0050674. RX PUBMED: 10487755. RA Fujii Y., Shimizu T., Kusumoto M., Kyogoku Y., Taniguchi T., Hakoshima T. RT Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences. RL EMBO J. 18:5028-5041 (1999). XX //