TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02478 XX ID T02478 XX DT 12.06.1998 (created); ewi. DT 14.09.2006 (updated); sri. CO Copyright (C), QIAGEN. XX FA NF-YC-isoform3 XX SY CAAT-box DNA-binding protein subunit C; DS2.8; HSM-1; Nuclear transcription factor Y subunit C; Nuclear transcription factor Y subunit gamma; Transactivator HSM-1/2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004106 NFYC; HGNC: NFYC. XX HO HAP4 (yeast). XX CL C0075; heteromer-CCAAT; 4.2.1.0.3.3. XX SZ 458 AA; 50.3 kDa (cDNA) (calc.). XX SQ MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM SQ ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR SQ DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII SQ AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP SQ VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTE SQ VQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAG SQ ASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ SQ LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD XX SC Swiss-Prot#Q13952-1 XX FT 41 105 PF00808; Histone-like transcription factor (CBF/. FT 45 108 PS50028; HIST_TAF. FT 52 398 PF00478; IMP dehydrogenase / GMP reductase domai. FT 108 115 interaction with p73alpha [4]. XX SF subunit of a trimeric DNA binding complex NF-YA:NF-YB:NF-YC, see T00150; SF C-terminal HAP5 domain is necessary for binding with p73alpha [4]; XX CP ubiquitous. XX FF as a subunit of the NF-Y complex, interacts directly with CIITA T05450 [2]; FF interacts directly with two subunits of the RFX complex, RFX5 T01672 and RFXANK T05441 [3]; FF interacts directly with p63alpha and p73alpha, but not with p53 and other isoforms of p73 [4]; XX IN T05450 C2TA; human, Homo sapiens. IN T01488 Cdk2; human, Homo sapiens. IN T01804 NF-YA; human, Homo sapiens. IN T00616 NF-YB; mouse, Mus musculus. IN T06148 p/CAF; human, Homo sapiens. IN T06132 p63-isoform1; human, Homo sapiens. IN T04931 p73alpha; human, Homo sapiens. IN T01672 rfx5; human, Homo sapiens. IN T05441 RFXANK; human, Homo sapiens. XX MX M07302 V$NFY_Q3. MX M00185 V$NFY_Q6. MX M00775 V$NFY_Q6_01. XX BS R16941. XX DR TRANSPATH: MO000026459. DR EMBL: D85425; DR UniProtKB: Q13952-1; XX RN [1]; RE0006902. RX PUBMED: 9287329. RA Orita T., Shimozaki K., Murakami H., Nagata S. RT Binding of NF-Y transcription factor to one of the cis-elements in the myeloperoxidase gene promoter that responds to granulocyte colony-stimulating factor RL J. Biol. Chem. 272:23216-23223 (1997). RN [2]; RE0022578. RX PUBMED: 11003667. RA Hake S. B., Masternak K., Kammerbauer C., Janzen C., Reith W., Steimle V. RT CIITA leucine-rich repeats control nuclear localization, in vivo recruitment to the major histocompatibility complex (MHC) class II enhanceosome, and MHC class II gene transactivation. RL Mol. Cell. Biol. 20:7716-7725 (2000). RN [3]; RE0022593. RX PUBMED: 12101253. RA Jabrane-Ferrat N., Nekrep N., Tosi G., Esserman L. J., Peterlin B. M. RT Major histocompatibility complex class II transcriptional platform: assembly of nuclear factor Y and regulatory factor X (RFX) on DNA requires RFX5 dimers. RL Mol. Cell. Biol. 22:5616-5625 (2002). RN [4]; RE0024850. RX PUBMED: 12167641. RA Hackzell A., Uramoto H., Izumi H., Kohno K., Funa K. RT p73 independent of c-Myc represses transcription of platelet-derived growth factor beta-receptor through interaction with NF-Y. RL J. Biol. Chem. 277:39769-39776 (2002). RN [5]; RE0035109. RX PUBMED: 9249075. RA Bellorini M., Zemzoumi K., Farina A., Berthelsen J., Piaggio G., Mantovani R. RT Cloning and expression of human NF-YC. RL Gene 193:119-125 (1997). XX //