TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05441 XX ID T05441 XX DT 21.02.2003 (created); oke. DT 01.09.2014 (updated); spk. CO Copyright (C), QIAGEN. XX FA RFXANK XX SY RFX-B. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G005107 RFXANK; HGNC: RFXANK. XX CL C0064; unchar-DBD; 0.0.3.0.1.1. XX SZ 260 AA; 28.1 kDa (calc.). XX SQ MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSS SQ PQAGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKP SQ DERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERD SQ VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ SQ VIENHILKLFQSNLVPADPE XX SC Swiss-Prot#O14593 XX FT 12 68 PEST-homology domain [2]. FT 69 123 required for DNA binding by the RFX complex [2]. FT 89 242 PS50297; ANK_REP_REGION. FT 122 155 ankyrin repeat 1, ank 1 [1]. FT 123 152 SM00248; ANK_2a. FT 123 155 PF00023; Ankyrin repeat. FT 123 155 PS50088; ANK_REPEAT. FT 156 188 ankyrin repeat 2, ank 2 [1]. FT 156 185 SM00248; ANK_2a. FT 156 188 PF00023; Ankyrin repeat. FT 156 188 PS50088; ANK_REPEAT. FT 189 222 ankyrin repeat 3, ank 3 [1]. FT 189 218 SM00248; ANK_2a. FT 189 221 PF00023; Ankyrin repeat. FT 189 221 PS50088; ANK_REPEAT. FT 222 251 SM00248; ANK_2a. XX SF subunit of RFX complex T05444 [1]; SF has no homology with two other subunits; SF region between PEST domain and ankyrin repeats may be involved in stabilization of the RFX complex or may bind directly to DNA [2]; SF ankyrin repeats are required for interaction with two other subunits, RFX5 T01672 and RFXAP T05443 [2]; XX FF important regulator of MHC class II gene expression, gene is mutated in MHC class II deficiency (complementation group B) [1] [3]; FF within the RFX complex, interacts directly with CIITA T05450 [4]; FF mediates interaction of the RFX complex and NF-Y, interacts directly with NF-YA and NF-YB [5]; XX IN T05450 C2TA; human, Homo sapiens. IN T08522 HDAC4-isoform1; human, Homo sapiens. IN T01804 NF-YA; human, Homo sapiens. IN T02478 NF-YC-isoform3; human, Homo sapiens. IN T08521 rfx5-isoform1; human, Homo sapiens. XX MX M00975 V$RFX_Q6. XX DR TRANSPATH: MO000034779. DR UniProtKB: O14593-1; XX RN [1]; RE0022532. RX PUBMED: 9806546. RA Masternak K., Barras E., Zufferey M., Conrad B., Corthals G., Aebersold R., Sanchez J. C., Hochstrasser D. F., Mach B., Reith W. RT A gene encoding a novel RFX-associated transactivator is mutated in the majority of MHC class II deficiency patients. RL Nat. Genet. 20:273-277 (1998). RN [2]; RE0022539. RX PUBMED: 10938133. RA DeSandro A. M., Nagarajan U. M., Boss J. M. RT Associations and interactions between bare lymphocyte syndrome factors. RL Mol. Cell. Biol. 20:6587-6599 (2000). RN [3]; RE0022542. RX PUBMED: 10072068. RA Nagarajan U. M., Louis-Plence P., DeSandro A., Nilsen R., Bushey A., Boss J. M. RT RFX-B is the gene responsible for the most common cause of the bare lymphocyte syndrome, an MHC class II immunodeficiency. RL Immunity 10:153-162 (1999). RN [4]; RE0022578. RX PUBMED: 11003667. RA Hake S. B., Masternak K., Kammerbauer C., Janzen C., Reith W., Steimle V. RT CIITA leucine-rich repeats control nuclear localization, in vivo recruitment to the major histocompatibility complex (MHC) class II enhanceosome, and MHC class II gene transactivation. RL Mol. Cell. Biol. 20:7716-7725 (2000). RN [5]; RE0022593. RX PUBMED: 12101253. RA Jabrane-Ferrat N., Nekrep N., Tosi G., Esserman L. J., Peterlin B. M. RT Major histocompatibility complex class II transcriptional platform: assembly of nuclear factor Y and regulatory factor X (RFX) on DNA requires RFX5 dimers. RL Mol. Cell. Biol. 22:5616-5625 (2002). XX //