![TRANSFAC-Logo](/transfac_factor/images/logo_genexplain.png)
AC T00641
XX
ID T00641
XX
DT 15.10.1992 (created); ewi.
DT 04.03.2015 (updated); pos.
CO Copyright (C), QIAGEN.
XX
FA POU2F1-isoform1
XX
SY (Ig)NF-A; alpha-H1; NF-A1; NF-III; OBP100; Oct-1; Oct-1B; oct-B1A; oct-B1B; octamer-binding factor; OTF-1; POU domain, class 2, transcription factor 1; POU2F1; TRF.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G005327 POU2F1; HGNC: POU2F1.
XX
CL C0007; POU; 3.1.10.2.1.1.
XX
SZ 743 AA; 76.5 kDa (cDNA) (calc.), 90, 92, 95 kDa (SDS)
XX
SQ MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
SQ LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
SQ LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
SQ QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLQTQLPQQSQANLLQSQ
SQ PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
SQ KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS
SQ SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
SQ EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
SQ VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
SQ SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
SQ SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
SQ FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
SQ NSLFTVASASGAASTTTTASKAQ
XX
SC Swiss-Prot#P14859-1
XX
FT 280 354
PF00157; Pou domain - N-terminal to homeobox domain.
FT 280 354
SM00352; pou.
FT 281 438
interaction with Stat5A [85].
FT 354 704
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 377 437
PS50071; HOMEOBOX_2.
FT 377 439
PS50550; POU_HOMEODOMAIN.
FT 379 441
SM00389; HOX_1.
FT 380 436
PF00046; Homeobox domain.
XX
SF alternative splice variants [52];
SF the bipartite DNA-binding (POU) domain comprises a POU-specific (POUs) and a POU homeo (POUh) domain [30];
SF the homeo domain contains a recognizable helix-turn-helix motif [80] [30] [16];
SF the POU-specific domain comprises 4 alpha-helices connected by short loops, forming an internal hydrophobic core and representing an extended helix-turn-helix motif;
SF helix 1 and 4 form a parallel coiled coil, helix 3 acts as recognition helix and is part of a structure that resembles that of bacteriophage repressors [77] [78] [80];
SF POUs contacts the 5'-half of the canonical ATGCAAAT, POUh the 3'-half [61] [80];
SF although not directly interacting within the molecule, POUs, POUh and the linker region in between together define the DNA-binding specificity of the whole POU domain [70] [80];
SF POUs induces DNA-bending [14];
SF KD for the canonical octamer element is 0.1 nM, whereas binding to the unrelated heptamer element (CTCATGA) has a KD of 20 nM [71];
SF interaction of two POU domains causes cooperative binding to adjacent octamer and heptamer elements [71];
SF another pattern recognized by Oct-1 is TAATGARAT, e. g. in the IE genes of HSV-1, frequently overlapping an octamer element [44] [8];
SF at this sequence, the complex depends on an intact POUh domain and also involves a viral activator (VP16) and one or two cellular components (C1 / HCF, C2) [61] [62];
SF in TAATGARAT, POUh contacts the 5'-half, the viral and/or C1 the 3'-half and 3' adjacent sequences [22] [62] [83] [13];
SF other reports describe the 3'-half to be contacted by the POUs domain with both POUs and POUh binding to DNA in the reverse order than on the normal octamer element [54];
SF this emphasizes the importance of the linker flexibility between POUs and POUh [55] [80];
SF only at the TAATGARAT element, Oct-1 adopts the conformation that is suitable for VP16 interaction, through POUh helix 1 and 2 with Glu-400 discriminating against Oct-2 [73] [74] [76] [81];
SF glutamine-rich N-terminal trans-activation domain [60];
SF transcriptionally inert C-terminus (contrasting to Oct-2) [60];
SF the second Glu-rich region activates only from binding sites that are proximal to the TATA box / initiation site [72];
SF direct interaction of POU with the C-terminal core domain of TBP [82];
XX
CP ubiquitous [16].
XX
FF transcriptional activator in the pol II and in the pol III system [58] [17];
FF also part of the replication machinery of adenovirus [48];
FF for stimulation of replication, the DNA-binding domain (whole POU domain) is required (POUs is inert, POUh inhibitory) and sufficient [10];
FF cooperative effects with Sp1, PR and/or GR, OAP40 [66] [68] [84];
FF differentially phosphorylated during cell cycle, possibly by a p34cdc2-related protein kinase during mitosis with concomitant activation of histone H2B gene [60] [64] [50];
FF mitosis-specific phosphorylation within the POUh domain at Ser-385 is achieved in vitro by PKA and inhibits DNA-binding [64];
FF down-regulated by IFN-alpha or by TPA [65];
FF in response to PRL or TPO-stimulation, STAT5 can bind to the Oct-GAS2 site in the cyclin D1 gene, if POU2F1-isoform1 is present [85];
XX
IN T10237 ATF-1; Mammalia.
IN T01030 CCF; human, Homo sapiens.
IN T08562 CREB1; human, Homo sapiens.
IN T09920 CREB1; Mammalia.
IN T02184 cyclinH; human, Homo sapiens.
IN T00118 HCF1-isoform1; human, Homo sapiens.
IN T02187 MAT1; human, Homo sapiens.
IN T02186 MO15; human, Homo sapiens.
IN T02141 OCA-B; human, Homo sapiens.
IN T00649 Oct-2; cat, Felis silvestris catus.
IN T00650 Oct-2; rat, Rattus rattus.
IN T08433 RXR-alpha; human, Homo sapiens.
IN T01578 STAT5A; sheep, Ovis aries.
IN T01579 STAT5A; mouse, Mus musculus.
IN T04683 STAT5A; human, Homo sapiens.
IN T04684 STAT5B; human, Homo sapiens.
IN T00794 TBP; human, Homo sapiens.
IN T02183 TFIIH-p62; human, Homo sapiens.
IN T02181 TFIIH-p90; human, Homo sapiens.
IN T00894 Vmw65; HSV-1, herpes simplex virus type 1.
XX
MX M00135 V$OCT1_01.
MX M00136 V$OCT1_02.
MX M00137 V$OCT1_03.
MX M00138 V$OCT1_04.
MX M00161 V$OCT1_05.
MX M00162 V$OCT1_06.
MX M00248 V$OCT1_07.
MX M01354 V$OCT1_08.
MX M00342 V$OCT1_B.
MX M00930 V$OCT1_Q5_01.
MX M00195 V$OCT1_Q6.
MX M00210 V$OCT_C.
MX M00795 V$OCT_Q6.
MX M07058 V$POU2F1_Q4.
MX M07059 V$POU2F1_Q4_01.
MX M03561 V$POU2F1_Q6.
XX
BS R01177.
BS R01176.
BS R01989.
BS R02001.
BS R03333.
BS R03334.
BS R03335.
BS R04676.
BS R00664.
BS R03010.
BS R08237.
BS R08238.
BS R15742.
BS R28361.
BS R00549.
BS R00551.
BS R00557.
BS R04196.
BS R04197.
BS R04200.
BS R04201.
BS R00662.
BS R00833.
BS R01635.
BS R01638.
BS R00932.
BS R00936.
BS R05055.
BS R05056.
BS R14543.
BS R15352.
BS R09467.
BS R04234.
BS R02571.
BS R18415.
BS R01500.
BS R00810.
BS R01917.
BS R00812.
BS R02732.
BS R02733.
BS R00814.
BS R00815.
BS R00820.
BS R00824.
BS R01734.
BS R00838.
BS R00842.
BS R00843.
BS R00869.
BS R00872.
BS R01682.
BS R00888.
BS R00890.
BS R00891.
BS R00892.
BS R00893.
BS R01778.
BS R01779.
BS R01780.
BS R03426.
BS R03427.
BS R02953.
BS R03383.
BS R13571.
BS R02225.
BS R04594.
BS R04595.
BS R04602.
BS R04708.
BS R04726.
BS R04727.
BS R04728.
BS R00666.
BS R03417.
BS R03418.
BS R03419.
BS R03420.
BS R05017.
BS R15482.
BS R01388.
BS R01389.
BS R01396.
BS R01399.
BS R01400.
BS R01401.
BS R01504.
XX
DR TRANSPATH: MO000035093.
DR TRANSCOMPEL: C00169.
DR TRANSCOMPEL: C00365.
DR TRANSCOMPEL: C00424.
DR EMBL: BC001664;
DR EMBL: BC003571;
DR EMBL: BC052274;
DR EMBL: S75007; S75007.
DR EMBL: X13403; HSOCT1.
DR UniProtKB: P14859-1;
DR PDB: 1pog.
XX
RN [1]; RE0000078.
RX PUBMED: 3677172.
RA Fletcher C., Heintz N., Roeder R. G.
RT Purification and Characterization of OTF-1, a Transcription Factor Regulating Cell Cycle Expression of a Human Histone H2b Gene
RL Cell 51:773-781 (1987).
RN [2]; RE0000085.
RX PUBMED: 2830987.
RA O'Hare P., Goding C. R.
RT Herpes Simplex Virus Regulatory Elements and the Immunoglobulin Octamer Domain Bind a Common Factor and Are Both Targets for Virion Transactivation
RL Cell 52:435-445 (1988).
RN [3]; RE0000087.
RX PUBMED: 2830986.
RA Preston C. M., Frame M. C., Campbell M. E. M.
RT A Complex formed between Cell Components and an HSV Structural Polypeptide Binds to a Viral Immediate Early Gene Regulatory DNA Sequence
RL Cell 52:425-434 (1988).
RN [4]; RE0000088.
RX PUBMED: 3091258.
RA Sen R., Baltimore D.
RT Multiple nuclear factors interact with the immunoglobulin enhancer sequences
RL Cell 46:705-716 (1986).
RN [5]; RE0000094.
RX PUBMED: 3119226.
RA Scheidereit C., Heguy A., Roeder R. G.
RT Identification and Purification of a Human Lymphoid-Specific Octamer-Binding Protein (OTF-2) That Activates Transcription of an Immunoglobulin Promoter In Vitro
RL Cell 51:783-793 (1987).
RN [6]; RE0000316.
RX PUBMED: 3428274.
RA Pruijn G. J. M., van Driel W., van Miltenburg R. T., van der Vliet P. C.
RT Promoter and enhancer elements containing a conserved sequence motif are recognized by nuclear factor III, a protein stimulating adenovirus DNA replication
RL EMBO J. 6:3771-3778 (1987).
RN [7]; RE0000352.
RX PUBMED: 2507313.
RA Kemler I., Schreiber E., Mueller M. M., Matthias P., Schaffner W.
RT Octamer transcription factors bind to two different sequence motifs of the heavy chain promoter
RL EMBO J. 8:2001-2008 (1989).
RN [8]; RE0000368.
RX PUBMED: 2826126.
RA Xiao J. H., Davidson I., Ferrandon D., Rosales R., Vigneron M., Macchi M., Ruffenach F., Chambon P.
RT One cell-specific and three ubiquitous proteins bind in vitro to overlapping motifs in the domain B1 of the SV40 enhancer
RL EMBO J. 6:3005-3013 (1987).
RN [9]; RE0000369.
RX PUBMED: 3072196.
RA Schreiber E., Matthias P., Mueller M. M., Schaffner W.
RT Identification of a novel lymphoid specific octamer binding protein (OTF-2B) by proteolytic clipping bandshift assay (PCBA)
RL EMBO J. 7:4221-4229 (1988).
RN [10]; RE0000390.
RX PUBMED: 2347308.
RA Verrijzer C. P., Kal A. J., van der Vliet P. C.
RT The DNA binding domain (POU domain) of transcription factor oct-1 suffices for stimulation of DNA replication
RL EMBO J. 9:1883-1888 (1990).
RN [11]; RE0000405.
RX PUBMED: 2826127.
RA Rosales R., Vigneron M., Macchi M., Davidson I., Xiao J. H., Chambon P.
RT In vitro binding of cell-specific and ubiquitous nuclear proteins to the octamer motif of the SV40 enhancer and related motifs present in other promoters and enhancers
RL EMBO J. 6:3015-3025 (1987).
RN [12]; RE0000424.
RX PUBMED: 2573524.
RA Schoeler H. R., Balling R., Hatzopoulos A. K., Suzuki N., Gruss P.
RT Octamer binding proteins confer transcriptional activity in early mouse embryogenesis
RL EMBO J. 8:2551-2557 (1989).
RN [13]; RE0000429.
RX PUBMED: 2556266.
RA Kristie T. M., LeBovitz J. H., Sharp P. A.
RT The octamer-binding proteins form multi-protein-DNA complexes with the HSV alphaTIF regulatory protein
RL EMBO J. 8:4229-4238 (1989).
RN [14]; RE0000528.
RX PUBMED: 1915275.
RA Verrijzer C. P., van Oosterhout J. A. W. M., van Weperen W. W., van der Vliet P. C.
RT POU proteins bend DNA via the POU-specific domain
RL EMBO J. 10:3007-3014 (1991).
RN [15]; RE0000592.
RX PUBMED: 2850260.
RA Baumruker T., Sturm R., Herr W.
RT OBP100 binds remarkably degenerate octamer motifs through specific interactions with flanking sequences
RL Genes Dev. 2:1400-1413 (1988).
RN [16]; RE0000605.
RX PUBMED: 2905684.
RA Sturm R. A., Das G., Herr W.
RT The ubiquitous octamer-binding protein Oct-1 contains a POU domain with a homeo box subdomain
RL Genes Dev. 2:1582-1599 (1988).
RN [17]; RE0000606.
RX PUBMED: 3264542.
RA LeBowitz J. H., Kobayashi T., Staudt L., Baltimore D., Sharp P. A.
RT Octamer-binding proteins from B or HeLa cells stimulate transcription of the immunoglobulin heavy-chain promoter in vitro
RL Genes Dev. 2:1227-1237 (1988).
RN [18]; RE0000608.
RX PUBMED: 2828167.
RA Sturm R., Baumruker T., Franza jr B. R., Herr W.
RT A 100-kD HeLa cell octamer binding protein (OBP100) interacts differently with two separate octamer-related sequences within the SV40 enhancer
RL Genes Dev. 1:1147-1160 (1987).
RN [19]; RE0000814.
RX PUBMED: 2826468.
RA O'Neill E. A., Kelly T. J.
RT Purification and Characterization of Nuclear Factor III (Origin Recognition Protein C), a Sequence-specific DNA Binding Protein Required for Efficient Initiation of Adenovirus DNA Replication
RL J. Biol. Chem. 263:931-937 (1988).
RN [20]; RE0001160.
RX PUBMED: 2214023.
RA Mul Y. M., Verrijzer C. P., van der Vliet P. C.
RT Transcription factors NFI and NFIII/oct-1 function independently, employing different mechanisms to enhance adenovirus DNA replication
RL J. Virol. 64:5510-5518 (1990).
RN [21]; RE0001180.
RX PUBMED: 1645782.
RA Spector D., Purves F., Roizman B.
RT Role of alpha-transducing factor (VP16) in the induction of alpha genes within the context of viral genomes
RL J. Virol. 65:3504-3513 (1991).
RN [22]; RE0001182.
RX PUBMED: 1658370.
RA Greaves R. F., O'Hare P.
RT Sequence, function, and regulation of the Vmw65 gene of herpes simplex virus type 2
RL J. Virol. 65:6705-6713 (1991).
RN [23]; RE0001291.
RX PUBMED: 2710122.
RA Poellinger L., Roeder R. G.
RT Octamer transcription factors 1 and 2 each bind to two different functional elements in the immunoglobulin heavy-chain promoter
RL Mol. Cell. Biol. 9:747-756 (1989).
RN [24]; RE0001313.
RX PUBMED: 2851727.
RA Stimac E., Lyons S., Pious D.
RT Transcription of HLA Class II Genes in the Absence of B-Cell-Specific Octamer-Binding Factor
RL Mol. Cell. Biol. 8:3734-3739 (1988).
RN [25]; RE0001367.
RX PUBMED: 2113179.
RA Nelms K., van Ness B.
RT Identification of an Octamer-Binding Site in the Human Kappa Light-Chain Enhancer
RL Mol. Cell. Biol. 10:3843-3846 (1990).
RN [26]; RE0001368.
RX PUBMED: 2109186.
RA Martin D. J., van Ness B. G.
RT Initiation and Processing of Two Kappa Immunoglobulin Germ Line Transcripts in Mouse B Cells
RL Mol. Cell. Biol. 10:1950-1958 (1990).
RN [27]; RE0001404.
RX PUBMED: 2511430.
RA Currie R. A., Roeder R. G.
RT Identification of an Octamer-Binding Site in the Mouse Kappa Light-Chain Immunoglobulin Enhancer
RL Mol. Cell. Biol. 9:4239-4247 (1989).
RN [28]; RE0001488.
RX PUBMED: 2204815.
RA Kamps M. P., Corcoran L., LeBowitz J. H., Baltimore D.
RT The promoter of the human interleukin-2 gene contains two octamer-binding sites and is partially activated by the expression of Oct-2
RL Mol. Cell. Biol. 10:5464-5472 (1990).
RN [29]; RE0001599.
RX PUBMED: 1996097.
RA Zhou D.-X., Yen T. S. B.
RT The ubiquitous transcription factor Oct-1 and the liver-specific factor HNF-1 are both required to activate transcription of a hepatitis B virus promoter
RL Mol. Cell. Biol. 11:1353-1359 (1991).
RN [30]; RE0001795.
RX PUBMED: 2904656.
RA Sturm R. A., Herr W.
RT The POU domain is a bipartite DNA-binding structure
RL Nature 336:601-604 (1988).
RN [31]; RE0001797.
RX PUBMED: 2571937.
RA Stern S., Tanaka M., Herr W.
RT The Oct-1 homoeodomain directs formation of a multiprotein-DNA complex with the HSV transactivator VP16
RL Nature 341:624-630 (1989).
RN [32]; RE0001800.
RX PUBMED: 3095662.
RA Staudt L. M., Singh H., Sen R., Wirth T., Sharp P. A., Baltimore D.
RT A lymphoid-specific protein binding to the octamer motif of immunoglobulin genes
RL Nature 323:640-643 (1986).
RN [33]; RE0001803.
RX PUBMED: 3027566.
RA Bohmann D., Keller W., Dale T., Schoeler H. R., Tebb G., Mattaj I. W.
RT A transcription factor which binds to the enhancers of SV40, immunoglobulin heavy chain and U2 snRNA genes
RL Nature 325:268-272 (1987).
RN [34]; RE0001955.
RX PUBMED: 2928110.
RA Pruijn G. J. M., van der Vliet P. C., Dathan N. A., Mattaj I. W.
RT Anti-OTF-1 antibodies inhibit NFIII stimulation of in vitro adenovirus DNA replication
RL Nucleic Acids Res. 17:1845-1863 (1989).
RN [35]; RE0001981.
RX PUBMED: 2734104.
RA Catala F., deBoer E., Habets G., Grosveld F.
RT Nuclear protein factors and erythroid transcription of the human Agamma-globin gene
RL Nucleic Acids Res. 17:3811-3827 (1989).
RN [36]; RE0001982.
RX PUBMED: 2922260.
RA Broggini M., Ponti M., Ottolenghi S., D'Incalci M., Mongelli N., Mantovani R.
RT Distamycins inhibit the binding of OTF-1 and NFE-1 transfactors to their conserved DNA elements
RL Nucleic Acids Res. 17:1051-1059 (1989).
RN [37]; RE0001983.
RX PUBMED: 2458563.
RA Mantovani R., Malgarettie N., Nicolis S., Ronchi A., Giglioni B., Ottolenghi S.
RT The effects of HPFH mutations in the human gamma-globin promoter on binding of ubiquitous and erythroid specific nuclear factors
RL Nucleic Acids Res. 16:7783-7797 (1988).
RN [38]; RE0001995.
RX PUBMED: 3122182.
RA Wang J., Nishiyama K., Araki K., Kitamura D., Watanabe T.
RT Purification of an octamer sequence (ATGCAAAT)-binding protein from human B cells
RL Nucleic Acids Res. 15:10105-10116 (1987).
RN [39]; RE0002050.
RX PUBMED: 2472607.
RA Lloyd J. A., Lee R. F., Lingrel L. B.
RT Mutations in two regions upstream of the Agamma globin gene canonical promoter affect gene expression
RL Nucleic Acids Res. 17:4339-4352 (1989).
RN [40]; RE0002056.
RX PUBMED: 2555786.
RA Shibuya H., Taniguchi T.
RT Identification of multiple cis-elements and trans-acting factors involved in the induced expression of human IL-2 gene
RL Nucleic Acids Res. 17:9173-9184 (1989).
RN [41]; RE0002148.
RX PUBMED: 2175881.
RA Katan M., Haigh A., Verrijzer C. P., van der Vliet P. C., O'Hare P.
RT Characterization of a cellular factor which interacts functionally with Oct-1 in the assembly of a multicomponent transcription complex
RL Nucleic Acids Res. 18:6871-6880 (1990).
RN [42]; RE0002172.
RX PUBMED: 1909431.
RA Hoegbom E., Magnusson A.-C., Leanderson T.
RT Functional modularity in the SP6 kappa promoter
RL Nucleic Acids Res. 19:4347-4354 (1991).
RN [43]; RE0002297.
RX PUBMED: 3462701.
RA Sive H. L., Roeder R. G.
RT Interaction of a common factor with conserved promoter and enhancer sequences in histone H2B, immunoglobulin, and U2 small nuclear RNA (snRNA) genes
RL Proc. Natl. Acad. Sci. USA 83:6382-6386 (1986).
RN [44]; RE0002310.
RX PUBMED: 2842768.
RA Gerster T., Roeder R. G.
RT A herpesvirus trans-activating protein interacts with transcription factor OTF-1 and other cellular proteins
RL Proc. Natl. Acad. Sci. USA 85:6347-6351 (1988).
RN [45]; RE0002311.
RX PUBMED: 3025864.
RA Kristie T. M., Roizman B.
RT Host cell proteins bind to the cis-acting site required for virion-mediated induction of herpes simplex virus 1 alpha genes
RL Proc. Natl. Acad. Sci. USA 84:71-75 (1987).
RN [46]; RE0002312.
RX PUBMED: 2823252.
RA McKnight J. L. C., Kristie T. M., Roizman B.
RT Binding of the virion protein mediating alpha gene induction in herpes simplex virus 1-infected cells to its cis site requires cellular proteins
RL Proc. Natl. Acad. Sci. USA 84:7061-7065 (1987).
RN [47]; RE0002612.
RX PUBMED: 3399892.
RA Staudt L. M., Clerc R. G., Singh H., LeBowitz J. H., Sharp P. A., Baltimore D.
RT Cloning of a lymphoid-specific cDNA encoding a protein binding the regulatory octamer DNA motif
RL Science 241:577-580 (1988).
RN [48]; RE0002623.
RX PUBMED: 3413485.
RA O'Neill E. A., Fletcher C., Burrow C. R., Heintz N., Roeder R. G., Kelly T. J.
RT Transcription factor OTF-1 is functionally identical to the DNA replication factor NF-III
RL Science 241:1210-1213 (1988).
RN [49]; RE0002650.
RX PUBMED: 2237431.
RA Ho I.-C., Bhat N. K., Gottschalk L. R., Lindsten R., Thompson C. B., Papas T. S., Leiden J. M.
RT Sequence-specific binding of human Ets-1 to the T cell receptor alpha gene enhancer
RL Science 250:814-818 (1990).
RN [50]; RE0002655.
RX PUBMED: 1887216.
RA Roberts S. B., Segil N., Heintz N.
RT Differential phosphorylation of the transcription factor Oct1 during cell cycle
RL Science 253:1022-1026 (1991).
RN [51]; RE0002767.
RX PUBMED: 2109187.
RA Yoza B. K., Roeder R. G.
RT Identification of a novel factor that interacts with an immunoglobulin heavy-chain promoter and stimulates transcription in conjunction with the lymphoid cell-specific factor OTF2
RL Mol. Cell. Biol. 10:2145-2153 (1990).
RN [52]; RE0004180.
RX PUBMED: 8227066.
RA Das G., Herr W.
RT Enhanced activation of the human histone H2B promoter by an Oct-1 variant generated by alternative splicing
RL J. Biol. Chem. 268:25026-25032 (1993).
RN [53]; RE0004182.
RX PUBMED: 8454622.
RA Kristie T. M., Sharp P. A.
RT Purification of the cellular C1 factor required for the stable recognition of the Oct-1 homeodomain by the herpes simplex virus alpha-trans-induction factor (VP16)
RL J. Biol. Chem. 268:6525-6534 (1993).
RN [54]; RE0004183.
RX PUBMED: 7891704.
RA Cleary M. A., Herr W.
RT Mechanisms for flexibility in DNA sequence recognition and VP16-induced complex formation by the Oct-1 POU domain
RL Mol. Cell. Biol. 15:2090-2100 (1995).
RN [55]; RE0004184.
RX PUBMED: 7622033.
RA Herr W., Cleary M. A.
RT The POU domain: versatility in tanscriptional regulation by a flexible two-in-one DNA-binding domain
RL Genes Dev. 9:1679-1693 (1995).
RN [56]; RE0004186.
RX PUBMED: 1970171.
RA Goldsborough A., Ashworth A., Willison K. R.
RT Cloning and sequencing of POU-boxes expressed in mouse testis
RL Nucleic Acids Res. 18:1634-1634 (1990).
RN [57]; RE0004189.
RX PUBMED: 1762932.
RA Sturm R. A.
RT An STS in the human oct-1 gene located on chromosome 1
RL Nucleic Acids Res. 19:6963-6963 (1991).
RN [58]; RE0004192.
RX PUBMED: 2532066.
RA Murphy S., Pierani A., Scheidereit C., Melli L., Roeder R. G.
RT Purified octamer binding transcription factors stimulate RNA polymerase III-mediated transcription of the 7SK RNA gene
RL Cell 59:1071-1080 (1989).
RN [59]; RE0004193.
RX PUBMED: 2167442.
RA Xiao P., Capone J. P.
RT A cellular factor binds to the herpes simplex virus type 1 transactivator Vmw65 and is required for Vmw65-dependent protein-DNA complex assembly with Oct-1
RL Mol. Cell. Biol. 10:4974-4977 (1990).
RN [60]; RE0004194.
RX PUBMED: 2302733.
RA Tanaka M., Herr W.
RT Differential transcriptional activation by Oct-1 and Oct-2: interdependent activation domains induce Oct-2 phosphorylation
RL Cell 60:375-386 (1990).
RN [61]; RE0004195.
RX PUBMED: 1980478.
RA Verrijzer C. P., Kal A. J., van der Vliet P. C.
RT The oct-1 homeo domain contacts only part of the octamer sequence and full oct-1 DNA-binding activity requires the POU-specific domain
RL Genes Dev. 4:1964-1974 (1990).
RN [62]; RE0004196.
RX PUBMED: 1980658.
RA Kristie T. M., Sharp P. A.
RT Interactions of the Oct-1 POU subdomains with specific DNA sequences and with the HSV a-trans-activator protein
RL Genes Dev. 4:2382-2396 (1990).
RN [63]; RE0004197.
RX PUBMED: 1650186.
RA Dent C. L., Latchman D. S.
RT The overlapping octamer/TAATGARAT motif is a high-affinity binding site for the cellular transcription factors Oct-1 and Oct-2
RL Biochem. J. 277:541-545 (1991).
RN [64]; RE0004198.
RX PUBMED: 1684878.
RA Segil N., Roberts S. B., Heintz N.
RT Mitotic phosphorylation of the Oct-1 homeodomain and regulation of Oct-1 DNA binding activity
RL Science 254:1814-1816 (1991).
RN [65]; RE0004199.
RX PUBMED: 1939139.
RA Dent C. L., Lillycrop K. A., Bybee A., Latchman D. S., Thomas N. S. B.
RT Interferon-a treatment of Daudi cells down-regulates the octamer binding transcription/DNA replication factors Oct-1 and Oct-2
RL J. Biol. Chem. 266:20888-20892 (1991).
RN [66]; RE0004200.
RX PUBMED: 2191301.
RA Janson L., Petersson U.
RT Cooperative interactions between transcription factors Sp1 and OTF-1
RL Proc. Natl. Acad. Sci. USA 87:4732-4736 (1990).
RN [67]; RE0004202.
RX PUBMED: 1684335.
RA Stern S., Herr W.
RT The herpes simplex virus trans-activator VP16 recognizes the Oct-1 homeo domain: evidence for a homeo domain recognition subdomain
RL Genes Dev. 5:2555-2566 (1991).
RN [68]; RE0004203.
RX PUBMED: 1683003.
RA Ullman K. S., Flanagan W. M., Edwards C. A., Crabtree G. R.
RT Activation of early gene expression in T lymphocytes by Oct-1 and an inducible protein, OAP40
RL Science 254:558-562 (1991).
RN [69]; RE0004204.
RX PUBMED: 1739980.
RA Tanaka M., Lai J.-S., Herr W.
RT Promoter-selective activation domains in Oct-1 and Oct-2 direct differential activation of an snRNA and mRNA promoter
RL Cell 68:755-767 (1992).
RN [70]; RE0004205.
RX PUBMED: 1732727.
RA Aurora R., Herr W.
RT Segments of the POU domain influence one another's DNA-binding specificity
RL Mol. Cell. Biol. 12:455-467 (1992).
RN [71]; RE0004206.
RX PUBMED: 1346336.
RA Verrijzer C. P., van Oosterhout J. A. W. M., van der Vliet P. C.
RT The Oct-1 POU domain mediates interactions between Oct-1 and other POU proteins
RL Mol. Cell. Biol. 12:542-551 (1992).
RN [72]; RE0004207.
RX PUBMED: 1464321.
RA Seipel K., Georgiev O., Schaffner W.
RT Different activation domains stimulte transcription from remote ('enhancer') and proximal ('promoter') positions
RL EMBO J. 11:4961-4968 (1992).
RN [73]; RE0004209.
RX PUBMED: 1358756.
RA Lai J.-S., Cleary M. A., Herr W.
RT A single amino acid exchange transfers VP16-induced positive control from the Oct-1 to the Oct-2 homeo domain
RL Genes Dev. 6:2058-2065 (1992).
RN [74]; RE0004210.
RX PUBMED: 1358755.
RA Pomerantz J. L., Kristie T. M., Sharp P. A.
RT Recognition of the surface of a homeo domain protein
RL Genes Dev. 6:2047-2057 (1992).
RN [75]; RE0004211.
RX PUBMED: 8392914.
RA Wilson A. C., LaMarco K., Peterson M. G., Herr W.
RT The VP16 accessory protein HCF is a family of polypeptides processed from a large precursor protein
RL Cell 74:115-125 (1993).
RN [76]; RE0004213.
RX PUBMED: 8422989.
RA Cleary M. A., Stern S., Tanaka M., Herr W.
RT Differential positive control by Oct-1 and Oct-2: activation of a transcriptionally silent motif through Oct-1 and VP16 corecruitment
RL Genes Dev. 7:72-83 (1993).
RN [77]; RE0004214.
RX PUBMED: 8462099.
RA Assa-Munt N., Mostishire-Smith R. J., Aurora R., Herr W., Wright P. E.
RT The solution structure of the Oct-1 POU-specific domain reveals a striking similarity to the bacteriophage l repressor DNA-binding domain
RL Cell 73:193-205 (1993).
RN [78]; RE0004216.
RX PUBMED: 8479524.
RA Dekker N., Cox M., Boelens R., Verrijzer C. P., van der Vliet P. C.
RT Solution structure of the POU-specific domain of Oct-1
RL Nature 362:852-855 (1993).
RN [79]; RE0004217.
RX PUBMED: 7957106.
RA Coenjaerts F. E. J., van Oosterhout J. A. W. M., van der Vliet P. C.
RT The Oct-1 POU domain stimulates adenovirus DNA replication by a direct interaction between the viral precursor terminal protein-DNA polymerase complex and the POU homeodomain
RL EMBO J. 13:5401-5409 (1994).
RN [80]; RE0004218.
RX PUBMED: 8156594.
RA Klemm J. D., Rould M. A., Aurora R., Herr W., Pabo C. O.
RT Crytsal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules
RL Cell 77:21-32 (1994).
RN [81]; RE0004219.
RX PUBMED: 8001121.
RA Walker S., Hayes S., O'Hare P.
RT Site-specific conformational alteration of the Oct-1 POU-domain-DNA complex as the basis for differential recognition by Vmw65 (VP16)
RL Cell 79:841-852 (1994).
RN [82]; RE0004220.
RX PUBMED: 8202368.
RA Zwilling S., Annweiler A., Wirth T.
RT The POU domains of the Oct1 and Oct2 transcription factors mediate specific interaction with TBP
RL Nucleic Acids Res. 22:1655-1662 (1994).
RN [83]; RE0004222.
RX PUBMED: 2556838.
RA Goding C. R., O'Hare P.
RT Herpes simplex virus Vmw65-octamer binding protein interaction: a paradigm for combinatorial control of transcription
RL Virology 173:363-367 (1989).
RN [84]; RE0016547.
RX PUBMED: 1846780.
RA Brueggemeier U., Kalff M., Franke S., Scheidereit C., Beato M.
RT Ubiquitous transcription factor OTF-1 mediates induction of the MMTV promoter through synergistic interaction with hormone receptors.
RL Cell 64:565-572 (1991).
RN [85]; RE0024933.
RX PUBMED: 14645506.
RA Magne S., Caron S., Charon M., Rouyez M. C., Dusanter-Fourt I.
RT STAT5 and Oct-1 form a stable complex that modulates cyclin D1 expression.
RL Mol. Cell. Biol. 23:8934-8945 (2003).
XX
//