AC T00797
XX
ID T00797
XX
DT 15.04.1993 (created); ewi.
DT 16.10.2004 (updated); vma.
CO Copyright (C), QIAGEN.
XX
FA TBP
XX
SY dTFIID; dTFIIDtau; TATA-binding protein; TBP.
XX
OS fruit fly, Drosophila melanogaster
OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae
XX
GE G002716 Tbp.
XX
SZ 353 AA; 38.4 kDa (cDNA) (calc.).
XX
SQ MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGSSSVQHQQQQQ
SQ QSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQQLQSQAPGGGGSTPQSMMQP
SQ QTPQSMMAHMMPMSERSVGGSGAGGGGDALSNIHQTMGPSTPMTPATPGSADPGIVPQLQ
SQ NIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKS
SQ EDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPE
SQ LFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQS
XX
SC Swiss-Prot#P20227
XX
FT 174 259 
PF00352; Transcription factor TFIID (or TATA-binding.
FT 264 350 
PF00352; Transcription factor TFIID (or TATA-binding.
XX
SF conserved core is sufficient for trans-activation [1];
SF assembly with different sets of TBP-associated factors (TAFII) mediates activation by different upstream binding factors [6];
SF pol II and pol III transcription machineries contact opposite TBP surfaces [3];
SF the pol-II-active TFIID probably is composed of TBP and 7 TAFII (of 250, 150, 110, 80, 60, 40 and 30 kDa) which may contain three additional components of 58, 22 and 21 kDa [8] [9];
SF in contrast, the pol-I-factor SL1 consists of TBP and 3 TAFI components (of 110, 63 and an additional polypeptide), and pol-III-factor TFIIIB comprises TBP and TAFIII170 and TAFIII70 [8];
XX
CP ubiquitous.
XX
FF activates basal transcription by binding to TATA box elements;
FF activation by upstream factors requires association of TBP with additional factors to form holo-TFIID [1];
FF apparently depending on the orientation of the TATA-box, TBP complexes activate transcription by either pol II or pol III [3];
FF DREF T04324 is involved in TBP expression [12];
XX
IN T00068 Brf1p; yeast, Saccharomyces cerevisiae.
IN T00182 DBF4; human, Homo sapiens.
IN T00530 NC1; human, Homo sapiens.
IN T02068 PU.1-isoform1; human, Homo sapiens.
IN T00702 PU.1; mouse, Mus musculus.
IN T00759 Sp1; human, Homo sapiens.
IN T00787 TAF-L; human, Homo sapiens.
IN T00784 TAFII100; human, Homo sapiens.
IN T02120 TAFII150; fruit fly, Drosophila melanogaster.
IN T00781 TAFII250-isoform2; human, Homo sapiens.
IN T02119 TAFII250; fruit fly, Drosophila melanogaster.
IN T02126 TAFII30alpha; fruit fly, Drosophila melanogaster.
IN T02124 TAFII60; fruit fly, Drosophila melanogaster.
IN T02122 TAFII80; fruit fly, Drosophila melanogaster.
IN T02225 TFIIA-L; fruit fly, Drosophila melanogaster.
IN T02226 TFIIA-S; fruit fly, Drosophila melanogaster.
IN T02157 TFIIA; fruit fly, Drosophila melanogaster.
IN T02158 TFIIB; fruit fly, Drosophila melanogaster.
IN T00894 Vmw65; HSV-1, herpes simplex virus type 1.
XX
MX M00252 V$TATA_01.
XX
BS R01001.
BS R00061.
XX
DR TRANSPATH: MO000045960.
DR EMBL: M38082; DMTFIID.
DR EMBL: M38388; DMTATABF.
DR UniProtKB: P20227; TF2D_DROME.
DR FLYBASE: FBgn0003687; Tbp.
XX
RN [1]; RE0000227.
RX PUBMED: 2194666.
RA Hoey T., Dynlacht B. D., Peterson M. G., Pugh B. F., Tjian R.
RT Isolation and characterization of the Drosophila gene encoding the TATA box binding protein, TFIID
RL Cell 61:1179-1186 (1990).
RN [2]; RE0000976.
RX PUBMED: 2040615.
RA Safer B., Reinberg D., Jacob W. F., Maldonado E., Carcamo J., Garfinkel S., Cohen R.
RT Interaction of CAP sequence site binding factor and transcription factor IID preceding and following binding to the adenovirus 2 major late promoter
RL J. Biol. Chem. 266:10989-10994 (1991).
RN [3]; RE0005509.
RX PUBMED: 7567983.
RA Wang Y., Stumph W. E.
RT RNA polymerase II/III transcription specificity determined by TATA box orientation
RL Proc. Natl. Acad. Sci. USA 92:8606-8610 (1995).
RN [4]; RE0005560.
RX PUBMED: 8262073.
RA Weinzierl R. O. J., Ruppert S., Dynlacht B. D., Tanese N., Tjian R.
RT Cloning and expression of Drosophila TAFII60 and human TAFII70 reveal conserved interactions with other subunits of TFIID
RL EMBO J. 12:5303-5309 (1993).
RN [5]; RE0005565.
RX PUBMED: 2123550.
RA Muhich M. L., Iida C. T., Horikoshi M., Roeder R. G., Parker C. S.
RT cDNA clone encoding Drosophila transcription factor TFIID
RL Proc. Natl. Acad. Sci. USA 87:9148-9152 (1990).
RN [6]; RE0005566.
RX PUBMED: 7923382.
RA Chen J.-L., Attardi L. D., Verrijzer C. P., Yokomori K., Tjian R.
RT Assembly of recombinant TFIID reveals differential coactivator requirements for distinct transcriptional coactivators
RL Cell 79:93-105 (1994).
RN [7]; RE0005567.
RX PUBMED: 8170939.
RA Kokubo T., Yamashita S., Horikoshi M., Roeder R. G., Nakatani Y.
RT Interaction between the N-terminal domain of the 230-kDa subunit and the TATA box-binding subunit of TFIID negatively regulates TATA-box binding
RL Proc. Natl. Acad. Sci. USA 91:3520-3524 (1994).
RN [8]; RE0005568.
RX PUBMED: 8464492.
RA Weinzierl R. O. J., Dynlacht B. D., Tjian R.
RT Largest subunit of Drosophila transcription factor IID directs assembly of a complex containing TBP and a coactivator
RL Nature 362:511-517 (1993).
RN [9]; RE0005569.
RX PUBMED: 8349634.
RA Kokubo T., Takada R., Yamashita S., Gong D.-W., Roeder R. G., Horikoshi M., Nakatani Y.
RT Identification of TFIID components required for transcriptional activation by upstream stimulatory factor
RL J. Biol. Chem. 268:17554-17558 (1993).
RN [10]; RE0005570.
RX PUBMED: 7545910.
RA Kokubo T., Gong D.-W., Wootton J. C., Horikoshi M., Roeder R. G., Nakatani Y.
RT Molecular cloning of Drosophila TFIID subunits
RL Nature 367:484-487 (1994).
RN [11]; RE0005571.
RX PUBMED: 8178153.
RA Verrijzer C. P., Yokomori K., Chen J.-L., Tjian R.
RT Drosophila TAFII150: similarity to yeast gene TSM-1 and specific binding to core promoter DNA
RL Science 264:933-941 (1994).
RN [12]; RE0016901.
RX PUBMED: 11033359.
RA Choi T., Cho N., Oh Y., Yoo M., Matsukage A., Ryu Y., Han K., Yoon J., Baek K.
RT The DNA replication-related element (DRE)-DRE-binding factor (DREF) system may be involved in the expression of the Drosophila melanogaster TBP gene
RL FEBS Lett. 483:71-77 (2000).
XX
//