TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02158 XX ID T02158 XX DT 26.05.1997 (created); hiwi. DT 25.11.2006 (updated); vma. CO Copyright (C), QIAGEN. XX FA TFIIB XX SY alpha (rat); CB; CG5193; CI; CT16633; dTFIIB; FA; factor e; TFIIB; Transcription factor IIB. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G014995 TfIIB. XX CL C0030; histone fold. XX SZ 315 AA; 34.4 kDa (cDNA) (calc.), 38 kDa (SDS) [4] XX SQ MASTSRLDNNKVCCYAHPESPLIEDYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSG SQ VDPSRVGGPENPLLSGGDLSTIIGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEI SQ SSMADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEIC SQ AVSKISKKEIGRCFKLTLKALETSVDLITTADFMCRFCANLDLPNMVQRAATHIAKKAVE SQ MDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFP SQ EDFKFTTPIDQLPQM XX SC Swiss-Prot#P29052 XX FT 21 105 required for basal transcription in addition to TBP-TATA-binding [7]. FT 105 315 binding to TBP-TATA complexes [7]. FT 118 199 SM00385; cyclin_7. FT 120 190 PF00382; Transcription factor TFIIB repeat. FT 179 190 homology to sigma2.1 region [4]. FT 184 199 cluster of basic residues, crucial for complex formation with TBP and TATA box [7]. FT 189 208 homology to sigma2.4 region [4]. FT 205 219 homology to sigma2.2 region [4]. FT 212 293 SM00385; cyclin_7. FT 214 284 PF00382; Transcription factor TFIIB repeat. FT 225 239 homology to sigma2.2 region [4]. XX SF mediates trans-activation by glutamine-rich activation domains, probably through a zinc-finger like structure near the N-terminus [3] [6]; XX FF may be involved in fixing the transcription start site [5]; XX IN T02125 TAFII40; fruit fly, Drosophila melanogaster. IN T00797 TBP; fruit fly, Drosophila melanogaster. XX DR TRANSPATH: MO000045990. DR EMBL: M88164; DMTFIIBA. DR EMBL: M91081; DMTFIIB. DR EMBL: U02879; DMFIIB. DR EMBL: U35148; DM35148. DR UniProtKB: P29052; TF2B_DROME. DR FLYBASE: FBgn0004915; TfIIB. XX RN [1]; RE0005533. RX PUBMED: 7875589. RA Lira-De Vito L. M., Burke T. W., Kadonaga J. T. RT Structure of the genes encoding transcription factor IIB and TATA box- binding protein from Drosophila melanogaster. RL Gene 153:203-207 (1995). RN [2]; RE0005607. RX PUBMED: 8221891. RA Goodrich J. A., Hoey T., Thut C. J., Admon A., Tjian R. RT Drosophila TAFII40 interacts with both a VP16 activation domain and the basal transcription factor TFIIB RL Cell 75:519-530 (1993). RN [3]; RE0005677. RX PUBMED: 7891725. RA Colgan J., Ashali H., Manley J. L. RT A direct interaction betwenn a glutamine-rich activato and the N terminus of TFIIB can mediate transcriptional activation in vivo RL Mol. Cell. Biol. 15:2311-2320 (1995). RN [4]; RE0005684. RX PUBMED: 1557390. RA Yamashita S., Wada K., Horikoshi M., Gong D.-W., Kokubo T., Hisatake K., Yokotani N., Malik S., Roeder R. G., Nakatani Y. RT Isolation and characterization of a cDNA encoding Drosophila transcription factor TFIIB RL Proc. Natl. Acad. Sci. USA 89:2839-2843 (1992). RN [5]; RE0005685. RX PUBMED: 1644295. RA Wampler S. L., Kadonaga J. T. RT Functional analysis of Drosophila transcription factor IIB RL Genes Dev. 6:1542-1552 (1992). RN [6]; RE0005694. RX PUBMED: 8464496. RA Colgan J., Wampler S., Manley J. L. RT Interaction between a transcriptional activator and transcription factor IIB in vivo RL Nature 362:549-553 (1993). RN [7]; RE0005696. RX PUBMED: 8332911. RA Yamashita S., Hisatake K., Kokubo T., Doi K., Roeder R. G., Horikoshi M., Nakatani Y. RT Transcription factor TFIIB sites important for interaction with promoter-bound TFIID RL Science 261:463-466 (1993). XX //