TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02125 XX ID T02125 XX DT 21.05.1997 (created); hiwi. DT 07.08.2013 (updated); mkl. CO Copyright (C), QIAGEN. XX FA TAFII40 XX SY TAF(II)40. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX HO TAF(II)31 (human). XX CL C0030; histone fold. XX SZ 278 AA; 29.3 kDa (cDNA) (calc.), 42 kDa (SDS) [2], 40 kDa (SDS) [4] [4] [2] XX SQ MSAEKSDKAKISAQIKHVPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDA SQ KVYANHARKKTIDLDDVRLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLR SQ LPPDRYCLTGVNYKLRATNQPKKMTKSAVEGRPLKTVVKPVSSANGPKRPHSVVAKQQVV SQ TIPKPVIKFTTTTTTKTVGSSGGSGGGGGQEVKSESTGAGGDLKMEVDSDAAAVGSIAGA SQ SGSGAGSASGGGGGGGSSGVGVAVKREREEEEFEFVTN XX SC translated from EMBL #L29540 XX FT 8 136 PF02291; Transcription initiation factor IID, 31kD. FT 22 84 PS50028; HIST_TAF. XX SF no direct interaction with TBP, but with TAF(II)60 [4]; SF exhibits very weak interactions with TAF(II)250, TAF(II)110, and TAF(II)58 [3]; SF binds acidic trans-activation domains [4]; SF pI(calc.) = 10.2 [4]; SF recruited to the TFIID complex by TAF(II)60 [1]; SF together with the histone H3-like region within TAFII40, the histone fold of TAF(II)60 may wrap DNA into a nucleosome-like structure, possibly facilitating histone displacement from the transcribed DNA [3]; XX FF part of TFIID complex [2] [4]; XX IN T02124 TAFII60; fruit fly, Drosophila melanogaster. IN T00783 TAFII70-alpha; human, Homo sapiens. IN T02158 TFIIB; fruit fly, Drosophila melanogaster. IN T00894 Vmw65; HSV-1, herpes simplex virus type 1. XX DR TRANSPATH: MO000045988. DR EMBL: L29540; DMDRTA. DR EMBL: U06458; DM06458. DR UniProtKB: Q27272; T2D5_DROME. DR FLYBASE: FBgn0000617; e(y)1. XX RN [1]; RE0005560. RX PUBMED: 8262073. RA Weinzierl R. O. J., Ruppert S., Dynlacht B. D., Tanese N., Tjian R. RT Cloning and expression of Drosophila TAFII60 and human TAFII70 reveal conserved interactions with other subunits of TFIID RL EMBO J. 12:5303-5309 (1993). RN [2]; RE0005569. RX PUBMED: 8349634. RA Kokubo T., Takada R., Yamashita S., Gong D.-W., Roeder R. G., Horikoshi M., Nakatani Y. RT Identification of TFIID components required for transcriptional activation by upstream stimulatory factor RL J. Biol. Chem. 268:17554-17558 (1993). RN [3]; RE0005570. RX PUBMED: 7545910. RA Kokubo T., Gong D.-W., Wootton J. C., Horikoshi M., Roeder R. G., Nakatani Y. RT Molecular cloning of Drosophila TFIID subunits RL Nature 367:484-487 (1994). RN [4]; RE0005607. RX PUBMED: 8221891. RA Goodrich J. A., Hoey T., Thut C. J., Admon A., Tjian R. RT Drosophila TAFII40 interacts with both a VP16 activation domain and the basal transcription factor TFIIB RL Cell 75:519-530 (1993). XX //