TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00781 XX ID T00781 XX DT 14.04.1993 (created); ewi. DT 30.12.2013 (updated); yre. CO Copyright (C), QIAGEN. XX FA TAFII250-isoform2 XX SY CCG1; p250; TAF-250; TAFII250; TBP-associated factor 250. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G009204 TAF1; HGNC: TAF1. XX CL C0015; HMG; 4.1.3.0.5.2. XX SZ 1893 AA; 214.7 kDa (cDNA) (calc.), 250 kDa (SDS) [13] [15] [9] XX SQ MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDD SQ ECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDE SQ SRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGVSE SQ NGEGIILPSIIAPSSLASEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDA SQ TKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVE SQ CSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVA SQ EWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLAD SQ ENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLD SQ DDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEE SQ ATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQG SQ LRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPL SQ LKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATK SQ IKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPE SQ TDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSK SQ DRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAM SQ VSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFI SQ AAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLS SQ LKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQ SQ ERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSR SQ EREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEY SQ VRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQE SQ KEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQ SQ EEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVG SQ TTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYK SQ IITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDE SQ KLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPD SQ YYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNV SQ CYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMS SQ RDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMS SQ EGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESM SQ MSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRS SQ GPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE XX SC PIR #A40262 XX FT 1 177 NF-kappaB homology region [15]. FT 146 372 missing in TAF(II)250delta [14]. FT 178 198 missing in CCG1 [14]. FT 514 1022 PF00478; IMP dehydrogenase / GMP reductase domain. FT 692 707 sigma4.1 homology region [15]. FT 987 1167 SWI4 homology region [15]. FT 1021 1031 sigma2.1 homology region [15]. FT 1141 1231 binding of TFIIF-alpha [20]. FT 1232 1260 sigma4.2 homology region [15]. FT 1399 1507 SM00297; bromo_6. FT 1406 1493 PF00439; Bromodomain. FT 1418 1488 PS50014; BROMODOMAIN_2. FT 1521 1630 SM00297; bromo_6. FT 1528 1616 PF00439; Bromodomain. FT 1541 1611 PS50014; BROMODOMAIN_2. XX SF TAFII250-isoform2, TAFII100 and TAFII28 are human coreTAF(II)s common to both TFIIDalpha and TFIIDbeta complexes [22]; SF probable splice variants are CCG1 T02206 and TAFII250-isoform2Delta T02207 [14]; SF part of the human TFIID (D-TFIID) complex [3]; SF interacting with the conserved C-terminal part of TBP where the second direct repeat is of particular importance [9] [14]; SF sequence similarity with NF-kappaB1 p105, position 733-900: 22% identity, 39% similarity [15]; SF homology with cell-cycle regulating yeast SWI4: 21% identity, 36% similarity [15]; SF part of the two direct repeats are two bromo domains; XX FF tight association with TBP, role in assembly of the TFIID complex; FF its interaction with TBP correlates with ability of TFIID to confer activation by upstream factors [7]; FF essential for cell cycle progression through G1 phase [19]; XX IN T00671 p53; human, Homo sapiens. IN T00722 pRb; human, Homo sapiens. IN T00784 TAFII100; human, Homo sapiens. IN T02328 TAFII135; human, Homo sapiens. IN T02118 TAFII30; human, Homo sapiens. IN T00782 TAFII55; human, Homo sapiens. IN T09238 TAFII55; human, Homo sapiens. IN T00783 TAFII70-alpha; human, Homo sapiens. IN T02208 TAFII70-gamma; human, Homo sapiens. IN T00794 TBP; human, Homo sapiens. IN T00797 TBP; fruit fly, Drosophila melanogaster. IN T02168 TFIIF-alpha; human, Homo sapiens. IN T01038 TFIIF; human, Homo sapiens. XX DR TRANSPATH: MO000025167. DR EMBL: D90359; DR EMBL: X07024; DR UniProtKB: P21675-2; XX RN [1]; RE0000746. RX PUBMED: 1398073. RA Zhou Q., Lieberman P. M., Boyer T. G., Berk A. J. RT Holo-TFIID supports transcriptional stimulation by diverse activators and from a TATA-less promoter RL Genes Dev. 6:1964-1974 (1992). RN [2]; RE0002494. RX PUBMED: 1465404. RA Takada R., Nakatani Y., Hoffmann A., Kokubo T., Hasegawa S., Roeder R. G., Horikoshi M. RT Identification of human TFIID components and direct interaction between a 250-kDa polypeptide and the TATA box-binding protein (TFIIDtau) RL Proc. Natl. Acad. Sci. USA 89:11809-11813 (1992). RN [3]; RE0002495. RX PUBMED: 1387711. RA Timmers H. T. M., Meyers R. E., Sharp P. A. RT Composition of transcription factor B-TFIID RL Proc. Natl. Acad. Sci. USA 89:8140-8144 (1992). RN [4]; RE0005507. RX PUBMED: 8758937. RA Dubrovskaya V., Lavigne A.-C., Davidson I., Acker J., Staub A., Tora L. RT Distinct domains of hTAFII100 are requireed for functional interactions with transcription factor TFIIbeta (RAP30) and incorporation into the TFIID complex RL EMBO J. 15:3702-3712 (1996). RN [5]; RE0005525. RX PUBMED: 7724524. RA Shao Z., Ruppert S., Robbins P. D. RT The retinoblastoma-susceptibility gene product binds directly to the human TATA-binding protein-associated factor TAFII250 RL Proc. Natl. Acad. Sci. USA 92:3115-3119 (1995). RN [6]; RE0005526. RX PUBMED: 7824954. RA Chiang C.-M., Roeder R. G. RT Cloning of an instrinsic human TFIID subunit that interacts with multiple transcriptional activators RL Science 267:531-536 (1995). RN [7]; RE0005555. RX PUBMED: 7958931. RA Tansey W. P., Ruppert S., Tjian R., Herr W. RT Multiple regions of TBP participate in the response to transcriptional activators in vivo RL Genes Dev. 8:2756-2769 (1994). RN [8]; RE0005557. RX PUBMED: 1657708. RA Pugh B. F., Tjian R. RT Transcription from a TATA-less promoter requires a multisubunit TFIID complex RL Genes Dev. 5:1935-1945 (1991). RN [9]; RE0005559. RX PUBMED: 8436290. RA Zhou Q., Boyer T. G., Berk A. J. RT Factors (TAFs) required for activated transcription interact with TATA box-binding protein conserved core domain RL Genes Dev. 7:180-187 (1993). RN [10]; RE0005560. RX PUBMED: 8262073. RA Weinzierl R. O. J., Ruppert S., Dynlacht B. D., Tanese N., Tjian R. RT Cloning and expression of Drosophila TAFII60 and human TAFII70 reveal conserved interactions with other subunits of TFIID RL EMBO J. 12:5303-5309 (1993). RN [11]; RE0005562. RX PUBMED: 7923369. RA Jacq X., Brou C., Lutz Y., Davidson I., Chambon P., Tora L. RT Human TAFII30 is present in a distinct TFIID complex and is required for transcriptional activation by the estrogen receptor RL Cell 79:107-117 (1994). RN [12]; RE0005568. RX PUBMED: 8464492. RA Weinzierl R. O. J., Dynlacht B. D., Tjian R. RT Largest subunit of Drosophila transcription factor IID directs assembly of a complex containing TBP and a coactivator RL Nature 362:511-517 (1993). RN [13]; RE0005583. RX PUBMED: 8183347. RA Kim T. K., Hashimoto S., Kelleher III R. J., Flanagan P. M., Kornberg R. D., Horikoshi M., Roeder R. G. RT Effects of activation-defective TBP mutations on transcription initiation in yeast RL Nature 369:252-255 (1994). RN [14]; RE0005584. RX PUBMED: 7680771. RA Ruppert S., Wang E. H., Tjian R. RT Cloning and expression of human TAFII250: a TBP-associated factor implicated in cell-cycle regulation RL Nature 362:175-179 (1993). RN [15]; RE0005585. RX PUBMED: 8450888. RA Hisatake K., Hasegawa S., Takada R., Nakatani Y., Horikoshi M., Roeder R. G. RT The p250 subunit of native TATA box-binding factor TFIID is the cell-cycle regulatory protein CCG1 RL Nature 362:179-181 (1993). RN [16]; RE0005586. RX PUBMED: 3169001. RA Sekiguchi T., Miyata T., Nishimoto T. RT Molecular cloning of the cDNA of human X chromosomal gene (CCG1) which complement the temperature sensitive G1 mutants, tsBN462 and ts13 of BHK cells RL EMBO J. 7:1683-1687 (1988). RN [17]; RE0005587. RX PUBMED: 1350857. RA Haynes S. R., Dollard C., Winston F., Beck S., Trowsdale J., Dawid I. B. RT The bromodomain: A conserved sequence found in human, Drosophila and yeast proteins RL Nucleic Acids Res. 20:2603-2603 (1992). RN [18]; RE0005588. RX PUBMED: 2038334. RA Sekiguchi T., Nohiro Y., Nakamura Y., Hisamoto N., Nishimoto T. RT The human CCG1 gene, essential for progression of the G1 phase, encodes a 210-kilodalton nuclear DNA-binding protein RL Mol. Cell. Biol. 11:3317-3325 (1991). RN [19]; RE0005589. RX PUBMED: 8303298. RA Wang E., Tjian R. RT Promoter-selective transcriptional defect in cell cycle mutant ts13 rescued by hTAFII250 RL Science 263:811-814 (1994). RN [20]; RE0005590. RX PUBMED: 7590250. RA Ruppert S., Tjian R. RT Human TAFII250 interacts with RAP74: implications for RNA polymerase II initiation RL Genes Dev. 9:2747-2755 (1995). RN [21]; RE0047697. RX PUBMED: 15988478. RA Kim T. H., Barrera L. O., Zheng M., Qu C., Singer M. A., Richmond T. A., Wu Y., Green R. D., Ren B. RT A high-resolution map of active promoters in the human genome. RL Nature 436:876-880 (2005). RN [22]; RE0005528. RX PUBMED: 7729427. RA Mengus G., May M., Jacq X., Staub A., Tora L., Chambon P., Davidson I. RT Cloning and characterization of hTAFII18, hTAFII20 and hTAFII28: three subunits of the human transcription factor TFIID RL EMBO J. 14:1520-1531 (1995). XX //