TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09238 XX ID T09238 XX DT 17.08.2006 (created); sri. DT 11.02.2015 (updated); spk. CO Copyright (C), QIAGEN. XX FA TAFII55 XX SY TAF(II)55; TAF-50; TAF-55; TBP-associated factor 55. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004666 TAF7; HGNC: TAF7. XX SZ 349 AA; 40.3 kDa (cDNA) (calc.), 46-50 kDa (SDS) [1] [2], 55kDa (SDS) [4] [4] [2] [1] XX SQ MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDR SQ VPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASK SQ KKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVRTR SQ WEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD SQ EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQNQIDNMKGKLQETQDRAK SQ RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK XX SC translated from EMBL #U18062 XX FT 12 178 PF04658; TAFII55 protein conserved region. FT 38 113 interaction with upstream activators [4]. FT 41 320 PF00478; IMP dehydrogenase / GMP reductase domain. FT 139 249 interaction with TAF(II)250 [4]. XX IN T08519 C2TA-isoform1; human, Homo sapiens. IN T01042 HSF1-L; human, Homo sapiens. IN T00781 TAFII250-isoform2; human, Homo sapiens. XX DR TRANSPATH: MO000085152. DR EMBL: U18062; DR UniProtKB: Q15545; XX RN [1]; RE0000746. RX PUBMED: 1398073. RA Zhou Q., Lieberman P. M., Boyer T. G., Berk A. J. RT Holo-TFIID supports transcriptional stimulation by diverse activators and from a TATA-less promoter RL Genes Dev. 6:1964-1974 (1992). RN [2]; RE0002495. RX PUBMED: 1387711. RA Timmers H. T. M., Meyers R. E., Sharp P. A. RT Composition of transcription factor B-TFIID RL Proc. Natl. Acad. Sci. USA 89:8140-8144 (1992). RN [3]; RE0005507. RX PUBMED: 8758937. RA Dubrovskaya V., Lavigne A.-C., Davidson I., Acker J., Staub A., Tora L. RT Distinct domains of hTAFII100 are requireed for functional interactions with transcription factor TFIIbeta (RAP30) and incorporation into the TFIID complex RL EMBO J. 15:3702-3712 (1996). RN [4]; RE0005526. RX PUBMED: 7824954. RA Chiang C.-M., Roeder R. G. RT Cloning of an instrinsic human TFIID subunit that interacts with multiple transcriptional activators RL Science 267:531-536 (1995). RN [5]; RE0031850. RX PUBMED: 11005381. RA Yuan C. X., Gurley W. B. RT Potential targets for HSF1 within the preinitiation complex. RL Cell Stress Chaperones 5:229-42 (2000). XX //