TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02226 XX ID T02226 XX DT 24.10.1997 (created); ewi. DT 24.10.1997 (updated); ewi. CO Copyright (C), QIAGEN. XX FA TFIIA-S XX SY dTFIIA-S; TFIIA-gamma. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX HO TFIIA-gamma (human), TOA2 (yeast). XX SZ 106 AA; 12.2 kDa (cDNA) (calc.), 14 kDa (SDS) [2] XX SQ MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKA SQ GKLNTYRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGKSGEF XX SC PIR #A54883 XX FT 1 49 PF02268; Transcription initiation factor IIA, ga. FT 51 101 PF02751; Transcription initiation factor IIA, ga. XX SF interacts with the N-terminal part of TFIIA-L and, thus, with the alpha subunit of TFIIA [1]; SF weak interaction with TBP [1]; XX FF regulated in response to the Ras signaling pathway [3]; XX IN T04454 GT-1; thale cress, Arabidopsis thaliana. IN T00797 TBP; fruit fly, Drosophila melanogaster. IN T02225 TFIIA-L; fruit fly, Drosophila melanogaster. XX DR TRANSPATH: MO000045978. DR EMBL: X83271; DMDTFIIAS. DR UniProtKB: P52656; T2AG_DROME. DR FLYBASE: FBgn0013347; TfIIA-S. XX RN [1]; RE0005665. RX PUBMED: 7958898. RA Yokomori K., Zeidler M. P., Chen J.-L., Verrijzer C. P., Mlodzik M. RT Drosophila TFIIA directs cooperative DNA binding with TBP and mediates transcriptional activation RL Genes Dev. 8:2313-2323 (1994). RN [2]; RE0005666. RX PUBMED: 8224849. RA Yokomori K., Admon A., Goodrich J. A., Chen J.-L., Tjian R. RT Drosophila TFIIA-L is processed into two subunits that are associated with the TBP/TAF complex RL Genes Dev. 7:2235-2245 (1993). RN [3]; RE0005667. RX PUBMED: 8557194. RA Zeidler M. P., Yokomori K., Tjian R., Moldzik M. RT Drosophila TFIIA-S is up-regulated and required during Ras-mediated photoreceptor determination RL Genes Dev. 10:50-59 (1996). XX //