TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00795 XX ID T00795 XX DT 16.11.1992 (created); ewi. DT 24.01.2008 (updated); smt. CO Copyright (C), QIAGEN. XX FA TBP XX SY SPT15; TATA-binding protein; TBP; TFIID; TFIIDtau; yBTF1. XX OS fission yeast, Schizosaccharomyces pombe OC Eukaryota; Fungi; Ascomycota; Archiascomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. XX CL C0082; TATA; F4.6.1.0.1. XX SZ 231 AA; 25.4 kDa (gene) (calc.). XX SQ MDFALPTTASQASAFMNNSSLTFPVLPNANNEATNETADSGDAEVSKNEGVSGIVPTLQN SQ IVATVNLDCRLDLKTIALHARNAEYNPKRFAAVIMRIREPKSTALIFASGKMVVLGGKSE SQ DDSKLASRKYARIIQKLGFNAKFTDFKIQNIVGSCDVKFPIRLEGLAYSHGTFSSYEPEL SQ FPGLIYRMVKPKVVLLIFVSGKIVLTGAKVREEIYQAFEAIYPVLSEFRKH XX SC Swiss-Prot#P17871 XX FT 53 138 PF00352; Transcription factor TFIID (or TATA-binding. FT 143 229 PF00352; Transcription factor TFIID (or TATA-binding. XX SF 93% sequence identity with S. cerevisiae TBP within the conserved core region [2]; XX FF although being highly conserved, the core region provides species-specific basic functions resulting in normal cell growth [3]; XX IN T00068 Brf1p; yeast, Saccharomyces cerevisiae. IN T00182 DBF4; human, Homo sapiens. IN T00530 NC1; human, Homo sapiens. IN T02068 PU.1-isoform1; human, Homo sapiens. IN T00702 PU.1; mouse, Mus musculus. IN T00759 Sp1; human, Homo sapiens. IN T00787 TAF-L; human, Homo sapiens. IN T00894 Vmw65; HSV-1, herpes simplex virus type 1. XX MX M00713 F$TBP_Q6. XX BS R02688. BS R00367. BS R00998. BS R23018. XX DR EMBL: X53415; SPTFIID. DR UniProtKB: P17871; TF2D_SCHPO. XX RN [1]; RE0000713. RX PUBMED: 2210373. RA Hoffmann A., Horikoshi M., Wang C. K., Schroeder St., Weil P. A., Roeder R. G. RT Cloning of the Schizosaccharomyces pombe TFIID gene reveals a strong conservation of functional domains present in Saccharomyces cerevisiae TFIID RL Genes Dev. 4:1141-1148 (1990). RN [2]; RE0005574. RX PUBMED: 2197558. RA Fikes J. D., Becker D. M., Winston F., Guarente L. RT Striking conservation of TFIID in Schizosaccharomyces pombe and Saccharomyces cerevisiae RL Nature 346:291-294 (1990). RN [3]; RE0005576. RX PUBMED: 2015627. RA Gill G., Tjian R. RT A highly conserved domain of TFIID displays species specificity in vivo RL Cell 65:333-340 (1991). XX //