AC T00272
XX
ID T00272
XX
DT 15.10.1992 (created); ewi.
DT 21.01.2016 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Eve
XX
SY Eve; Even-skipped.
XX
OS fruit fly, Drosophila melanogaster
OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae
XX
GE G000099 eve.
XX
HO Evx-1, Evx-2 (vertebrates).
XX
CL C0006; homeo.
XX
SZ 376 AA; 40.0 kDa (cDNA) (calc.), 44 kDa (SDS)
XX
SQ MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSR
SQ GSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQN
SQ RRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVAT
SQ NPMMATGMPPMGMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHH
SQ PHMMGSSATGSSYSAGAAGLLGALPSATCYTGLGVGVPKTQTPPLDLQSSSSPHSSTLSV
SQ SPVGSDHAKVFDRSPVAQSAPSVPAPAPLTTTSPLPAPGLLMPSAKRPASDMSPPPTTTV
SQ IAEPKPKLFKPYKTEA
XX
SC Swiss-Prot#P06602
XX
FT 5 311 PF00478; IMP dehydrogenase / GMP reductase domain.
FT 68 128 PS50071; HOMEOBOX_2.
FT 70 132 SM00389; HOX_1.
FT 71 127 PF00046; Homeobox domain.
XX
SF equal affinity for two classes of DNA-sequences following two distinct consensi (A/T-rich or G/C-rich, resp.) [5] [3];
SF both types of DNA-binding are mediated by the homeo domain [3];
SF proline-rich and hydrophobic repressor domain of 57 AA [8];
SF non-repressing variants exhibit higher DNA-binding affinity [8];
XX
CP odd parasegments.
XX
FF pair-rule gene product, generally acting as repressor [8] [14] [1];
FF activator of en [3];
FF repression may occur first through affinity binding (KD < 1 nM), followed by subsequent medium- and low-affinity binding (KD = 10 nM) where competition with activator binding may cause the repression [9];
FF as a result, Eve may uniformly cover large sequence stretches [16];
FF before repressing, e. g., run and ftz genes, Eve transiently activates them during a brief 20-30 min stage in the development [14];
FF positively autoregulates its own expression [3];
FF may also interfere with preinitiation transcription complex formation [17];
FF in addition to regulating segmentation, Eve also is required for normal development of certain neurons of the CNS [13];
FF expression is controlled by a two-step program: the initial induction of a seven-stripe expression pattern is mediated by some gap gene (Hb, Gt, Kr, also: Bcd) products, different stripes being under control of distinct control regions of the eve gene [4] [15] [6] [7];
FF later, eve expression is regulated through a single region by the action of periodically expressed regulators such as Eve itself [12];
XX
MX M02339 I$EVE_01.
MX M00629 I$EVE_Q6.
MX M00940 V$E2F1_Q6_01.
XX
BS R17242.
BS R17244.
BS R17246.
BS R17247.
BS R24672.
BS R00411.
BS R00412.
BS R00413.
BS R00418.
BS R02801.
BS R03029.
BS R03031.
BS R17421.
BS R17424.
BS R17427.
BS R01281.
BS R01283.
BS R01284.
BS R17329.
BS R01529.
BS R01888.
XX
DR TRANSPATH: MO000024821.
DR EMBL: M14767;
DR EMBL: X05138;
DR UniProtKB: P06602;
DR FLYBASE: FBgn0000606; eve.
XX
RN [1]; RE0000149.
RX PUBMED: 2569362.
RA Biggin M. D., Tjian R.
RT A Purified Drosophila Homeodomain Protein Represses Transcription In Vitro
RL Cell 58:433-440 (1989).
RN [2]; RE0000735.
RX PUBMED: 1671662.
RA Jiang J., Hoey T., Levine M.
RT Autoregulation of a segmentation gene in Drosophila: combinatorial interaction of the even-skipped homeo box protein with a distal enhancer element
RL Genes Dev. 5:265-277 (1991).
RN [3]; RE0001244.
RX PUBMED: 2905420.
RA Hoey T., Warrior R., Manak J., Levine M.
RT DNA-Binding Activities of Drosophila melanogaster even-skipped Protein Are Mediated by Its Homeo Domain and Influenced by Protein Context
RL Mol. Cell. Biol. 8:4598-4607 (1988).
RN [4]; RE0001333.
RX PUBMED: 1968224.
RA Yamaguchi M., Nishida Y., Moriuchi T., Hirose F., Hui C.-C., Suzuki Y., Matsugake A.
RT Drosophila proliferating cell nuclear antigen (cyclin) gene: structure, expression during development, and specific binding of homeodomain proteins to its 5'-flanking region
RL Mol. Cell. Biol. 10:872-879 (1990).
RN [5]; RE0001777.
RX PUBMED: 2895896.
RA Hoey T., Levine M.
RT Divergent homeo box proteins recognize similar DNA sequences in Drosophila
RL Nature 332:858-861 (1988).
RN [6]; RE0002797.
RX PUBMED: 2026328.
RA Small S., Kraut R., Hoey T., Warrior R., Levine M.
RT Transcriptional regulation of a pair-rule stripe in Drosophila
RL Genes Dev. 5:827-839 (1991).
RN [7]; RE0002830.
RX PUBMED: 1683715.
RA Stanojevic D., Small S., Levine M.
RT Regulation of segmentation stripe by overlapping activators and repressors in the Drosophila embryo
RL Science 254:1385-1387 (1991).
RN [8]; RE0005053.
RX PUBMED: 8095483.
RA Han K., Manley J. L.
RT Transcriptional repression by the Drosophila Even-skipped protein: definition of a minimal repression domain
RL Genes Dev. 7:491-503 (1993).
RN [9]; RE0005054.
RX PUBMED: 8097276.
RA TenHarmsel A., Austin R. J., Savenelli N., Biggin M. D.
RT Cooperative binding at a distance by even-skipped protein correlates with repression and suggests a mechanism of silencing
RL Mol. Cell. Biol. 13:2742-2752 (1993).
RN [10]; RE0005055.
RX PUBMED: 2877745.
RA Macdonald P. M., Ingham P., Struhl G.
RT Isolation, structure, and expression of even-skipped: A second pair-rule gene of Drosophila containing a homeo box
RL Cell 47:721-734 (1986).
RN [11]; RE0005056.
RX PUBMED: 2884106.
RA Frasch M., Hoey T., Rushlow C., Doyle H., Levine M.
RT Characterization and localization of the even-skipped protein of Drosophila
RL EMBO J. 6:749-759 (1987).
RN [12]; RE0005057.
RX PUBMED: 2720776.
RA Goto T., Macdonald P., Maniatis T.
RT Early and late periodic patterns of even skipped expression are controlled by distinct regulatory elements that respond to different spatial cues
RL Cell 57:413-422 (1989).
RN [13]; RE0005058.
RX PUBMED: 3374572.
RA Doe C. Q., Smouse D., Goodman C. S.
RT Control of neuronal fate by the Drosophila segmentation gene even-skipped
RL Nature 333:376-378 (1988).
RN [14]; RE0005059.
RX PUBMED: 1355458.
RA Manoukian A. S., Krause H. M.
RT Concentration-dependent activities of the even-skipped protein in Drosophila embryos
RL Genes Dev. 6:1740-1751 (1992).
RN [15]; RE0005060.
RX PUBMED: 1327756.
RA Small S., Blair A., Levine M.
RT Regulation of even-skipped stripe 2 in the Drosophila embryo
RL EMBO J. 11:4047-4057 (1992).
RN [16]; RE0005061.
RX PUBMED: 7958848.
RA Walter J., Dever C. A., Biggin M. D.
RT Two homeo domain proteins bind with similar specificity to a wide range of DNA sites in Drosophila embryos
RL Genes Dev. 8:1678-1692 (1994).
RN [17]; RE0005062.
RX PUBMED: 1358759.
RA Johnson F. B., Krasnow M. A.
RT Differential regulation of transcription preinitiation complex assembly by activator and repressor homeo domain protein
RL Genes Dev. 6:2177-2189 (1992).
XX
//