
AC T00456
XX
ID T00456
XX
DT 02.11.1992 (created); ewi.
DT 28.08.2007 (updated); apk.
CO Copyright (C), QIAGEN.
XX
FA Kr
XX
SY Kr; Krueppel; Kruppel.
XX
OS fruit fly, Drosophila melanogaster
OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae
XX
GE G000112 Kr.
XX
CL C0001; CH.
XX
SZ 466 AA; 50.8 kDa (calc.).
XX
SQ MSISMLQDAQTRTLAAALAGIKQEDVHLDRSMSLSPPMSANTSATSAAAIYPAMGLQQAA
SQ AASAFGMLSPTQLLAANRQAAAFMAQLPMSTLANTLFPHNPAALFGAWAAQQSLPPQGTH
SQ LHSPPASPHSPLSTPLGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEISMSVNDMY
SQ LSSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNH
SQ ERTHTGEKPFECPECDKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVH
SQ TGERPYTCEICDGKFSDSNQLKSHMLVHTGEKPFECERCHMKFRRRHHLMNHKCGIQSPP
SQ TPALSPAMSGDYPVAISAIAIEASTNRFAAMCATYGSSNESVDMEKATPETMVHWICLKM
SQ EPALWMAITATSHGARHRTFVGFSGCLHRKSLTYPVICLSKPSQRI
XX
SC Swiss-Prot#P07247
XX
FT 222 244
PF00096; zf-C2H2.
FT 222 244
SM00355; c2h2final6.
FT 222 249
PS50157; ZINC_FINGER_C2H2_2.
FT 250 272
PF00096; zf-C2H2.
FT 250 272
SM00355; c2h2final6.
FT 250 277
PS50157; ZINC_FINGER_C2H2_2.
FT 278 300
PF00096; zf-C2H2.
FT 278 300
SM00355; c2h2final6.
FT 278 305
PS50157; ZINC_FINGER_C2H2_2.
FT 306 328
PF00096; zf-C2H2.
FT 306 328
SM00355; c2h2final6.
FT 306 333
PS50157; ZINC_FINGER_C2H2_2.
FT 334 362
PS50157; ZINC_FINGER_C2H2_2.
XX
SF 5 zinc finger motifs;
SF alanine-rich region;
XX
FF transcriptional activator/repressor;
FF negatively regulated by Hunchback and Bicoid;
FF repressor of eve stripe 2 element;
FF repressor of hairy in stripe 6;
FF activator of hairy in stripes 3 to 5;
FF repressor of engrailed;
XX
IN T00818 TFIIB; human, Homo sapiens.
IN T00822 TFIIE; human, Homo sapiens.
XX
MX M00021 I$KR_01.
MX M07954 I$KR_04.
MX M01089 I$KR_Q6.
XX
BS R05425.
BS R05426.
BS R05427.
BS R05428.
BS R05429.
BS R05430.
BS R17238.
BS R00412.
BS R02486.
BS R02488.
BS R02493.
BS R02497.
BS R02499.
BS R02501.
BS R02609.
BS R02610.
BS R17433.
BS R17437.
BS R17439.
BS R17441.
BS R17444.
BS R17445.
BS R17448.
BS R17454.
BS R17512.
BS R17513.
BS R17647.
BS R17653.
BS R17655.
BS R17657.
BS R17666.
BS R02619.
BS R02620.
BS R17718.
BS R17721.
BS R17722.
BS R17723.
BS R17724.
BS R17935.
BS R17936.
BS R17937.
BS R17700.
BS R17708.
BS R17713.
BS R17714.
BS R17572.
BS R02605.
BS R02608.
BS R04543.
XX
DR TRANSPATH: MO000024940.
DR EMBL: X03414;
DR UniProtKB: P07247;
DR FLYBASE: FBgn0001325; Kr.
XX
RN [1]; RE0000140.
RX PUBMED: 3096579.
RA Schuh R., Aicher W., Gaul U., Cote S., Preiss A., Maier D., Seifert E., Nauber U., Schroeder C., Kemler R., Jaeckle H.
RT A conserved family of nuclear proteins containing structural elements of the finger protein encoded by Krueppel, a Drosophila segmentation gene
RL Cell 47:1025-1032 (1986).
RN [2]; RE0000511.
RX PUBMED: 2065664.
RA Hoch M., Seifert E., Jaeckle H.
RT Gene expression mediated by cis-acting sequences of the Krueppel gene in response to the Drosophila morphogens bicoid and hunchback
RL EMBO J. 10:2267-2278 (1991).
RN [3]; RE0000732.
RX PUBMED: 1671661.
RA Zuo P., Stanojevic D., Colgan J., Han K., Levine M., Manley J. L.
RT Activation and repression of transcription by the gap proteins hunchback and Krueppel in cultured Drosophila cells
RL Genes Dev. 5:254-264 (1991).
RN [4]; RE0001832.
RA Rosenberg U. B., Schroeder C., Preiss A., Kienlin A., Cote S., Riede I., Jaeckle H.
RT Structural homology of the product of the Drosophila Krueppel gene with Xenopus transcription factor IIIA
RL Nature 319:336-339 (1986).
RN [5]; RE0001854.
RX PUBMED: 2507923.
RA Stanojevic D., Hoey T., Levine M.
RT Sequence-specific DNA-binding activities of the gap proteins encoded by hunchback and Krueppel in Drosophila
RL Nature 341:331-335 (1989).
RN [6]; RE0001855.
RX PUBMED: 2797150.
RA Treisman J., Desplan C.
RT The products of the Drosophila gap genes hunchback and Krueppel bind to the hunchback promoters
RL Nature 341:335-337 (1989).
RN [7]; RE0001856.
RX PUBMED: 2797151.
RA Pankratz M. J., Hoch M., Seifert E., Jaeckle H.
RT Krueppel requirement for knirps enhancement reflects overlapping gap gene activities in the Drosophila embryo
RL Nature 341:337-340 (1989).
RN [8]; RE0001884.
RX PUBMED: 2114551.
RA Licht J. D., Grossel M. J., Figge J., Hansen U. M.
RT Drosophila Krueppel protein is a transcriptional repressor
RL Nature 346:76-79 (1990).
RN [9]; RE0001886.
RX PUBMED: 1922363.
RA Sauer F., Jaeckle H.
RT Concentration-dependent transcriptional activation or repression by Krueppel from a single binding site
RL Nature 353:563-566 (1991).
RN [10]; RE0002396.
RX PUBMED: 2499886.
RA Gaul U., Redemann N., Jaeckle H.
RT Single amino acid exchanges in the finger domain impair the function of the Drosophila gene Krueppel (Kr)
RL Proc. Natl. Acad. Sci. USA 86:4599-4603 (1989).
RN [11]; RE0002512.
RX PUBMED: 1905819.
RA Jacob Y., Sather S., Martin J. R., Ollo R.
RT Analysis of Krueppel control elements reveals that localized expression results from the interaction of multiple subelements
RL Proc. Natl. Acad. Sci. USA 88:5912-5916 (1991).
RN [12]; RE0002797.
RX PUBMED: 2026328.
RA Small S., Kraut R., Hoey T., Warrior R., Levine M.
RT Transcriptional regulation of a pair-rule stripe in Drosophila
RL Genes Dev. 5:827-839 (1991).
RN [13]; RE0002801.
RX PUBMED: 1902805.
RA Riddihough G., Ish-Horowicz D.
RT Individual stripe regulatory elements in the Drosophila hairy promoter respond to maternal, gap, and pair-rule genes
RL Genes Dev. 5:840-854 (1991).
RN [14]; RE0002830.
RX PUBMED: 1683715.
RA Stanojevic D., Small S., Levine M.
RT Regulation of segmentation stripe by overlapping activators and repressors in the Drosophila embryo
RL Science 254:1385-1387 (1991).
RN [15]; RE0017191.
RX PUBMED: 2377231.
RA Hulskamp M., Pfeifle C., Tautz D.
RT A morphogenetic gradient of hunchback protein organizes the expression of the gap genes Kruppel and knirps in the early Drosophila embryo
RL Nature 346:577-580 (1990).
XX
//