AC T00691
XX
ID T00691
XX
DT 15.10.1992 (created); ewi.
DT 27.08.2007 (updated); ask.
CO Copyright (C), QIAGEN.
XX
FA Pit-1A
XX
SY GHF-2; LSF-1; Pit-1; Pit-1a; Pituitary-specific factor 1; POU1F1a; PUF-1; PUF-I.
XX
OS rat, Rattus norvegicus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G000740 Pou1f1.
XX
CL C0007; POU; 3.1.10.1.1.1.
XX
SZ 317 AA; 35.8 kDa (cDNA) (calc.), 43 kDa (SDS) [2], 33.0 + 34.5 kDa (SDS) [2]
XX
SQ MSCQPFTSADTFIPLNSDASAALPLRMHHSAAEGLPASNHATNVMSTVPSILSLIQTPKC
SQ LHTYFSMTTMGNTATGLHYSVPSCHYGNQPSTYGVMAGTLTPCLYKFPDHTLSHGFPPLH
SQ QPLLAEDPTASEFKQELRRKSKLVEEPIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVG
SQ EALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERK
SQ RKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKT
SQ SLNQSLFSISKEHLECR
XX
SC Swiss-Prot#P10037-2
XX
FT 10 40 
major trans-activation domain [15].
FT 150 224 
PF00157; Pou domain - N-terminal to homeobox domain.
FT 150 224 
SM00352; pou.
FT 238 298 
PS50071; HOMEOBOX_2.
FT 238 300 
PS50550; POU_HOMEODOMAIN.
FT 240 302 
SM00389; HOX_1.
FT 241 297 
PF00046; Homeobox domain.
XX
SF alternative splicing gives rise to a 291 AA protein which is the major form;
SF Pit-1A makes approximately 1/7 of all POU1F1 mRNA in pituitary cells [17] [20];
SF alternative translation initiation gives rise to another product of 31 kDa [23];
SF both POUs and POUh contact DNA [15];
SF POUh domain is sufficient for DNA-binding, POUs and the linker region between POUs and POUh augment in enhancing affinity and specificity [15] [19] [9];
SF POUs induces bending of the DNA [4];
SF free in solution: POU1F1 monomers or POU1F1/POU2F1 T00643 heterodimers, homodimers form upon DNA-binding [15] [29];
SF interacts physically with PITX2 T02413 to facilitate DNA binding [28];
XX
CP lactotrophs, somatotrophs and thyrotrophs of anterior pituitary gland [18] [6] [2].
CN gonadotrophs of anterior pituitary gland, posterior pituitary, heart, hypothalamus, kidney, liver, prostate, testis, thyroid [18] [6] [2].
XX
FF tissue-specific activator [9] [2];
FF although binding to POU1F1 sites like POU1F1b, it trans-activates the growth hormone (GH) gene, but not the Prl and GHF1 promoters (in contrast to GHF-1) due to the 26 AA insertion [17];
FF transcription of the pit-1 gene is triggered by environmental stimuli that enhance intracellular cAMP concentrations [22];
FF autoregulation through several promoter and enhancer elements [21] [22] [25];
FF may also be regulated through a potent vitamin D3 responsive element [25];
FF may be subject of differential cell-type specific translational control [18];
FF activity at the GH promoter is counteracted by activin [16];
FF acts with PITX2 T02413 to synergistically transactivate the prolactin gene promoter [28];
XX
IN T02413 pitx2; human, Homo sapiens.
XX
MX M01465 V$PIT1_01.
MX M00802 V$PIT1_Q6.
MX M03559 V$PIT1_Q6_01.
MX M00744 V$POU1F1_Q6.
XX
BS R02160.
BS R03190.
BS R03191.
BS R03955.
BS R16148.
BS R00609.
BS R00611.
BS R00612.
BS R19140.
BS R19141.
BS R02783.
BS R02784.
BS R02786.
BS R02787.
BS R02789.
BS R02790.
BS R02791.
BS R02792.
BS R03481.
BS R03483.
BS R16142.
BS R16144.
BS R16145.
BS R16149.
BS R13387.
BS R13388.
BS R16143.
BS R16146.
BS R16147.
BS R16150.
BS R20583.
BS R74086.
BS R00622.
BS R00623.
BS R13389.
BS R01263.
BS R01264.
BS R01265.
BS R01266.
BS R01270.
BS R01273.
BS R01276.
BS R01279.
BS R01280.
BS R74087.
XX
DR TRANSPATH: MO000025109.
DR TRANSCOMPEL: C00047.
DR TRANSCOMPEL: C00131.
DR TRANSCOMPEL: C00137.
DR TRANSCOMPEL: C00360.
DR TRANSCOMPEL: C00361.
DR TRANSCOMPEL: C00362.
DR TRANSCOMPEL: C00363.
DR TRANSCOMPEL: C00364.
DR TRANSCOMPEL: C00366.
DR TRANSCOMPEL: C00367.
DR EMBL: X63089;
DR EMBL: X65364;
DR EMBL: X65365;
DR EMBL: X65367;
DR EMBL: X65368;
DR UniProtKB: P10037-2;
XX
RN [1]; RE0000072.
RX PUBMED: 3594572.
RA Bodner M., Karin M.
RT A Pituitary-Specific Trans-Acting Factor Can Stimulate Transcription from the Growth Hormone Promoter in Extracts of Nonexpressing Cells
RL Cell 50:267-275 (1987).
RN [2]; RE0000076.
RX PUBMED: 2902928.
RA Ingraham H. A., Chen R., Mangalam H. J., Elsholtz H. P., Flynn S. E., Lin C. R., Simmons D. M., Swanson L., Rosenfeld M. G.
RT A tissue-specific transcription factor containing a homeodomain specifies a pituitary phenotype
RL Cell 55:519-529 (1988).
RN [3]; RE0000347.
RX PUBMED: 3595566.
RA Lefevre C., Imagawa M., Dana S., Grindlay J., Bodner M., Karin M.
RT Tissue-specific expression of the human growth hormone gene is conferred in part by the binding of a specific trans-acting factor
RL EMBO J. 6:971-981 (1987).
RN [4]; RE0000528.
RX PUBMED: 1915275.
RA Verrijzer C. P., van Oosterhout J. A. W. M., van Weperen W. W., van der Vliet P. C.
RT POU proteins bend DNA via the POU-specific domain
RL EMBO J. 10:3007-3014 (1991).
RN [5]; RE0000616.
RX PUBMED: 2307370.
RA Elsholtz H. P., Albert V. R., Treacy M. N., Rosenfeld M. G.
RT A two-base change in a POU factor-binding site switches pituitary-specific to lymphoid-specific gene expression
RL Genes Dev. 4:43-51 (1990).
RN [6]; RE0000645.
RX PUBMED: 2550324.
RA Mangalam H. J., Albert V. R., Ingraham H. A., Kapiloff M., Wilson L., Nelson Ch., Elsholtz H., Rosenfeld M. G.
RT A pituitary POU domain protein, Pit-1, activates both growth hormone and prolactin promoters transcriptionally
RL Genes Dev. 3:946-958 (1989).
RN [7]; RE0001331.
RX PUBMED: 3683387.
RA Cao Z., Barron E. A., Carillo A. J., Sharp Z. D.
RT Reconstitution of Cell-Type-Specific Transcription of the Rat Prolactin Gene In Vitro
RL Mol. Cell. Biol. 7:3402-3408 (1987).
RN [8]; RE0001332.
RX PUBMED: 3244361.
RA Cao Z., Barron E. A., Sharp Z. D.
RT Prolactin Upstream Factor I Mediates Cell-Specific Transcription
RL Mol. Cell. Biol. 8:5432-5438 (1988).
RN [9]; RE0001790.
RX PUBMED: 2574416.
RA Theill L. E., Castrillo J.-L., Wu D., Karin M.
RT Dissection of functional domains of the pituitary-specific transcription factor GHF-1
RL Nature 342:945-948 (1989).
RN [10]; RE0002021.
RX PUBMED: 2717408.
RA Sharp Z. D., Helsel S., Cao Z., Barron E. A., Sanchez Y.
RT DNA recognition element required for PUF-I mediated cell-type specific transcription of the rat prolactin gene
RL Nucleic Acids Res. 17:2705-2722 (1989).
RN [11]; RE0002079.
RX PUBMED: 1976240.
RA Schaufele F., West B. L., Reudelhuber T.
RT Somatotroph- and lactotroph-specific interactions with the homeobox protein binding sites in the rat growth hormone gene promoter
RL Nucleic Acids Res. 18:5235-5244 (1990).
RN [12]; RE0002474.
RX PUBMED: 1901656.
RA Steinfelder H. J., Hauser P., Nakayama Y., Radovick S., McClaskey J. H., Taylor T., Weintraub B. D., Wondisford F. E.
RT Thyrotropin-releasing hormone regulation of human TSHB expression: Role of a pituitary-specific transcription factor (Pit-1/GHF-1) and potential interaction with a thyroid hormone-inhibitory element
RL Proc. Natl. Acad. Sci. USA 88:3130-3134 (1991).
RN [13]; RE0002599.
RX PUBMED: 2831625.
RA Nelson C., Albert V. R., Elsholtz H. P., Lu L. I.-W., Rosenfeld M. G.
RT Activation of cell-specific expression of rat growth hormone and prolactin genes by a common transcription factor
RL Science 239:1400-1405 (1988).
RN [14]; RE0002639.
RX PUBMED: 2563596.
RA Castrillo J.-L., Bodner M., Karin M.
RT Purification of growth hormone-specific transcription factor GHF-1 containing homeobox
RL Science 243:814-817 (1989).
RN [15]; RE0002735.
RX PUBMED: 2350782.
RA Ingraham H. A., Flynn S. E., Voss J. W., Albert V. R., Kapiloff M. S., Wilson L., Rosenfeld M. G.
RT The POU-specific domain of Pit-1 is essential for sequence-specific, high affinity DNA binding and DNA-dependent Pit-1-Pit-1 interactions
RL Cell 61:1021-1033 (1990).
RN [16]; RE0002950.
RX PUBMED: 1454833.
RA Struthers R. S., Gaddy-Kurten D., Vale W. W.
RT Activin inhibits binding of transcription factor Pit-1 to the growth hormone promoter
RL Proc. Natl. Acad. Sci. USA 89:11451-11455 (1992).
RN [17]; RE0003111.
RX PUBMED: 1600947.
RA Theill L. E., Hattori K., Lazzaro D., Castrillo J.-L., Karin M.
RT Differential splicing of the GHF1 primary transcript gives rise to two functionally distinct homeodomain proteins
RL EMBO J. 11:2261-2269 (1992).
RN [18]; RE0003182.
RX PUBMED: 2379827.
RA Simmons D.M., Voss J.W., Ingraham H.A., Holloway J.M., Broide R.S., Rosenfeld M.G., Swanson L.W.
RT Pituitary cell phenotypes involve cell-specific Pit-1 mRNA translation and synergistic interactions with other classes of transcription factors
RL Genes Dev. 4:695-711 (1990).
RN [19]; RE0004205.
RX PUBMED: 1732727.
RA Aurora R., Herr W.
RT Segments of the POU domain influence one another's DNA-binding specificity
RL Mol. Cell. Biol. 12:455-467 (1992).
RN [20]; RE0004420.
RX PUBMED: 1561093.
RA Morris A. E., Kloss B., McCesney R. E., Bancroft C., Chasin L. A.
RT An alternatively spliced Pit-1 isoform altered in its ability to trans-activate
RL Nucleic Acids Res. 20:1355-1361 (1992).
RN [21]; RE0004424.
RX PUBMED: 2142999.
RA Chen R., Ingraham H. A., Treacy M. N., Albert V. R., Wilson L., Rosenfeld M. G.
RT Autoregulation of pit-1 gene expression mediated by two cis-active promoter elements
RL Nature 346:583-586 (1990).
RN [22]; RE0004427.
RX PUBMED: 1972784.
RA McCormick A., Brady H., Theill L. E., Karin M.
RT Regulation of the pituitary-specific homeobox gene GHF1 by cell-autonomous and environmental cues
RL Nature 345:829-832 (1990).
RN [23]; RE0004428.
RX PUBMED: 2071572.
RA Voss J. W., Yao T.-P., Rosenfeld M. G.
RT Alternative translation initiation site usage results in two structurally distinct forms of Pit-1
RL J. Biol. Chem. 266:12832-12835 (1991).
RN [24]; RE0004431.
RX PUBMED: 1779976.
RA Hoggard N., Davis J. R. E., Berwaer M., Monget P., Peers B., Belayew A., Martial J. A.
RT Pit-1 binding sequences permit calcium regulation of human prolactin gene expression
RL Mol. Endocrinol. 5:1748-1754 (1991).
RN [25]; RE0004438.
RX PUBMED: 8504933.
RA Rhodes S. J., Chen R., DiMattia G. E., Scully K. M., Kalla K. A., Lin S.-C., Yu V. C., Rosenfeld M. G.
RT A tissue-specific enhancer confers Pit-1-dependent morphogen inducibility and autoregulation on the pit-1 gene
RL Genes Dev. 7:913-932 (1993).
RN [26]; RE0004439.
RX PUBMED: 8163504.
RA Lew A. M., Yao H., Elsholtz H. P.
RT Gia2- and G0a-mediated signaling in the Pit-1-dependent inhibition of the prolactin gene promoter
RL J. Biol. Chem. 269:12007-12013 (1994).
RN [27]; RE0004445.
RX PUBMED: 1775132.
RA Yan G. Z., Bancroft C.
RT Mediation by calcium of thyrotropin--releasing hormone action on the prolactin promoter via transcription factor pit-1
RL Mol. Endocrinol. 5:1488-1497 (1991).
RN [28]; RE0016332.
RX PUBMED: 9685346.
RA Amendt B. A., Sutherland L. B., Semina E. V., Russo A. F.
RT The molecular basis of Rieger Syndrome
RL J. Biol. Chem. 273:20066-20072 (1998).
RN [29]; RE0016563.
RX PUBMED: 2065979.
RA Voss J. W., Wilson L., Rosenfeld M. G.
RT POU-domain proteins Pit-1 and Oct-1 interact to form a heteromeric complex and can cooperate to induce expression of the prolactin promoter.
RL Genes Dev. 5:1309-1320 (1991).
RN [30]; RE0016603.
RX PUBMED: 7673116.
RA Howard P. W., Maurer R. A.
RT A composite Ets/Pit-1 binding site in the prolactin gene can mediate transcriptional responses to multiple signal transduction pathways.
RL J. Biol. Chem. 270:20930-20936 (1995).
RN [31]; RE0022675.
RX PUBMED: 1321428.
RA Steinfelder H. J., Radovick S., Wondisford F. E.
RT Hormonal regulation of the thyrotropin beta-subunit gene by phosphorylation of the pituitary-specific transcription factor Pit-1.
RL Proc. Natl. Acad. Sci. USA 89:5942-5945 (1992).
RN [32]; RE0022755.
RX PUBMED: 1652153.
RA Kapiloff M. S., Farkash Y., Wegner M., Rosenfeld M. G.
RT Variable effects of phosphorylation of Pit-1 dictated by the DNA response elements.
RL Science 253:786-789 (1991).
XX
//