TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00789 XX ID T00789 XX DT 03.11.1992 (created); ewi. DT 27.01.2016 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Tll XX SY NR2E2; Tailless; TLL. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G009908 tll. XX HO vertebrate Tll/Txl. XX CL C0002; CC (rec). XX SZ 452 AA; 50.5 kDa (cDNA) (calc.). XX SQ MQSSEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKR SQ SIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRH SQ MAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPS SQ AAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHL SQ FKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANR SQ EIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTG SQ SGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKV SQ SSFTIEELFFRKTIGDITIVRLISDMYSQRKI XX SC Swiss-Prot#P18102 XX FT 31 104 SM00399; c4gold. FT 31 108 PS51030; NUCLEAR_REC_DBD_2. FT 32 109 PF00105; Zinc finger, C4 type (two domains). FT 173 447 PF00478; IMP dehydrogenase / GMP reductase domai. FT 234 421 SM00430; holi. FT 237 446 PF00104; Ligand-binding domain of nuclear hormon. XX SF tll mutants lack abdominal segment 8 and the telson and show skeletal abnormalities in the anterior [3]; XX CP (embryonic) early: anterior and posterior domain, later: anterior -> developing brain, temporal in the PNS [3]. XX FF repressor of Krueppel expression; FF activator of hairy in stripe 7; XX MX M03155 I$TLL_01. MX M00679 I$TLL_Q6. XX BS R17490. BS R17491. BS R17691. BS R17692. BS R17693. BS R17694. BS R17695. BS R17696. BS R17697. BS R17698. BS R17699. BS R17440. BS R17450. BS R17638. BS R17644. BS R17648. BS R17658. BS R17665. BS R04959. BS R04960. BS R04961. BS R04962. BS R02274. BS R02276. BS R02277. BS R02279. BS R02281. BS R02282. BS R02285. BS R17352. BS R17355. BS R17361. BS R17577. BS R17583. XX DR TRANSPATH: MO000025174. DR EMBL: M34639; DR UniProtKB: P18102; DR FLYBASE: FBgn0003720; tll. XX RN [1]; RE0002689. RX PUBMED: 1348871. RA Hoch M., Gerwin N., Taubert H., Jaeckle H. RT Competition for overlapping sites in the regulatory region of the Drosophila gene Krueppel RL Science 256:94-97 (1992). RN [2]; RE0002801. RX PUBMED: 1902805. RA Riddihough G., Ish-Horowicz D. RT Individual stripe regulatory elements in the Drosophila hairy promoter respond to maternal, gap, and pair-rule genes RL Genes Dev. 5:840-854 (1991). RN [3]; RE0006664. RX PUBMED: 2364433. RA Pignoni F., Baldarelli R. M., Steingrimsson E., Diaz R. J., Patapoutian A., Merriam J. R., Lengyel J. A. RT The Drosophila Gene tailless is Expressed at the Embryonic Termini and Is a Member of the Steroid Receptor Superfamily RL Cell 62:151-163 (1990). RN [4]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). XX //