TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01078 XX ID T01078 XX DT 24.02.1994 (created); ewi. DT 16.10.2014 (updated); mka. CO Copyright (C), QIAGEN. XX FA GBF1 XX SY AT4G36730; G-box binding factor 1; GBF1. XX OS thale cress, Arabidopsis thaliana OC eukaryota; viridiplantae; embryobionta; magnoliophyta; magnoliopsida; dilleniidae; capparales; brassicaceae XX GE G006969 GBF1. XX CL C0008; bZIP; P1.1.5.3.4. XX SZ 315 AA; 33.9 kDa (calc.). XX SQ MGTSEDKMPFKTTKPTSSAQEVPPTPYPDWQNSMQAYYGGGGSPNPFFPSPVGSPSPHPY SQ MWGAQHHMMPPYGTPVPYPAMYPPGAVYAHPSMPMPPNSGPTNKEPAKDQASGKKSKGNS SQ KKKAEGGDKALSGSGNDGASHSDESVTAGSSDENDENANQQEQGSIRKPSFGQMLADASS SQ QSTTGEIQGSVPMKPVAPGTNLNIGMDLWSSQAGVPVKDERELKRQKRKQSNRESARRSR SQ LRKQAECEQLQQRVESLSNENQSLRDELQRLSSECDKLKSENNSIQDELQRVLGAEAVAN SQ LEQNAAGSKDGEGTN XX SC Swiss-Prot#P42774 XX FT 1 159 PF07777; G-box binding protein MFMR. FT 112 164 cytoplasmic retention [3]. FT 201 209 GCB motif [2]. FT 220 284 PF00170; bZIP transcription factor. FT 220 284 SM00338; brlzneu. FT 222 285 PS50217; BZIP. XX SF GCB motif (Amino acids 201 to 209) functions as a transcriptional activator [2]; SF the leucine zipper may extend to position 306 (L5IVAA); SF binds palindromic recognition sequence in a symmetrical manner; SF the proline rich region interacts with GPRI1 and GPRI2 [5]; XX CP leaves, roots. XX FF constitutively expressed [1]; FF to more than 50% localized in the cytoplasm [3]; FF binding activity is stimulated by phosphorylation [4]; XX IN T01079 GBF2; thale cress, Arabidopsis thaliana. IN T01080 GBF3; thale cress, Arabidopsis thaliana. IN T04365 GF14; thale cress, Arabidopsis thaliana. IN T05579 GLK1; thale cress, Arabidopsis thaliana. IN T05580 GPRI2; thale cress, Arabidopsis thaliana. XX MX M08812 P$GBF1F_Q2. MX M01806 P$GBF1_01. MX M01838 P$GBF1_Q2. MX M08813 P$GBF1_Q2_01. MX M00441 P$GBF_Q2. XX BS R32914. BS R32915. BS R32916. BS R32917. BS R32918. BS R32919. BS R32920. BS R32921. BS R32922. BS R32923. BS R32924. BS R32925. BS R32926. BS R32927. BS R32928. BS R32929. BS R32930. BS R32931. BS R32932. BS R32933. BS R32934. BS R32935. BS R32936. BS R32937. BS R32938. BS R32939. BS R32940. BS R32941. BS R32942. BS R32943. BS R32944. BS R32945. BS R32946. BS R32947. BS R32948. BS R32949. BS R32950. BS R32951. BS R32952. BS R32953. BS R32954. BS R32955. BS R32956. BS R32957. BS R32958. BS R03630. BS R61154. BS R61175. BS R61179. BS R64386. BS R34071. BS R34072. BS R32910. BS R61675. BS R03283. BS R34426. BS R01315. BS R34073. BS R32904. BS R32907. BS R32911. BS R01320. BS R00679. BS R32908. XX DR EMBL: X63894; DR EMBL: X99941; DR UniProtKB: P42774; XX RN [1]; RE0000534. RX PUBMED: 1373374. RA Schindler U., Menkens A. E., Beckmann A., Ecker J. R., Cashmore A. R. RT Heterodimerization between light-regulated and ubiquitous expressed Arabidopsis GBF bZIP proteins RL EMBO J. 11:1261-1273 (1992). RN [2]; RE0013756. RX PUBMED: 9078369. RA Okanami M., Meshi T., Tamai H., Iwabuchi M. RT HALF-1, a bZIP-type protein, interacting with the wheat transcription factor HBP-1a contains a novel transcriptional activation domain. RL Genes Cells 1:87-99 (1996). RN [3]; RE0013758. RX PUBMED: 9193069. RA Terzaghi W. B., Bertekap jr R. L., Cashmore A. R. RT Intracellular localization of GBF proteins and blue light-induced import of GBF2 fusion proteins into the nucleus of cultured Arabidopsis and soybean cells. RL Plant J. 11:967-982 (1997). RN [4]; RE0013759. RX PUBMED: 1525562. RA Klimczak L. J., Schindler U., Cashmore A. R. RT DNA binding activity of the Arabidopsis G-box binding factor GBF1 is stimulated by phosphorylation by casein kinase II from broccoli. RL Plant Cell 4:87-98 (1992). RN [5]; RE0022887. RX PUBMED: 11828027. RA Tamai H., Iwabuchi M., Meshi T. RT Arabidopsis GARP transcriptional activators interact with the Pro-rich activation domain shared by G-box-binding bZIP factors. RL Plant Cell 43:99-107 (2002). RN [6]; RE0053834. RX PUBMED: 18315949. RA Shen H., Cao K., Wang X. RT AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana. RL BMB reports 41:132-138 (2008). XX //