TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01153 XX ID T01153 XX DT 26.04.1994 (created); ewi. DT 23.03.2010 (updated); ada. CO Copyright (C), QIAGEN. XX FA T3R-alpha2 XX SY c-erbA-1; c-ErbA-alpha; c-ErbA-T; EAR-7; ear-7-2; EAR7; Nuclear receptor subfamily 1 group A member 1; T3R-alpha2; thyroid hormone receptor alpha; thyroid hormone receptor alpha2; TR. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004672 THRA; HGNC: THRA. XX CL C0002; CC (rec); 2.1.2.2.1.2. XX SZ 490 AA; 54.8 kDa (cDNA) (calc.). XX SQ MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA SQ TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM SQ AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA SQ QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS SQ ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF SQ ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI SQ PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL SQ GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC SQ EDLAGNAASP XX SC Swiss-Prot#P10827-1 XX FT 50 123 SM00399; c4gold. FT 50 127 PS51030; NUCLEAR_REC_DBD_2. FT 51 128 PF00105; Zinc finger, C4 type (two domains). FT 83 431 PF00478; IMP dehydrogenase / GMP reductase domai. FT 220 378 SM00430; holi. FT 223 420 PF00104; Ligand-binding domain of nuclear hormon. XX SF splice variant from THRA (c-arbA-1) gene [3]; SF conflict in protein sequence between EMBL entry #Y00479 and SWISSPROT entry #P21205: pos. 37 (S versus T), pos. 119 (A versus G); XX FF T3-binding with KD = 0.38 nM; FF no heterodimers with RXR-alpha; FF moderately inhibits positive regulation by T3R-alpha1 and T3R-beta, but does not affect negative regulation by T3R-alpha1 and T3R-beta; FF probably competes for a co-factor required for positive alpha1/beta function; XX MX M01724 V$T3RALPHA_Q6. MX M00963 V$T3R_Q6. XX BS R01465. BS R04765. BS R03102. BS R03523. XX DR TRANSPATH: MO000025447. DR UniProtKB: P10827-1; XX RN [1]; RE0001757. RX PUBMED: 2284000. RA Rentoumis A., Chatterjee V. K., Madison L. D., Datta S., Gallagher G. D., DeGroot L. J., Jameson J. L. RT Negative and positive transcriptional regulation by thyroid hormone receptor isoforms RL Mol. Endocrinol. 4:11522-1531 (1990). RN [2]; RE0001853. RX PUBMED: 2569164. RA Sap J., Munoz A., Schmitt J., Stunnenberg H., Vennstroem B. RT Repression of transcription mediated at a thyroid hormone response element by the v-erb-A oncogene product RL Nature 340:242 (1989). RN [3]; RE0002102. RX PUBMED: 1850510. RA Laudet V., Begue A., Henry-Duthoit C., Joubel A., Martin P., Stehelin D., Saule S. RT Genomic organization of the human thyroid hormone receptor alpha (c-erbA-1) gene RL Nucleic Acids Res. 19:1105-1112 (1991). RN [4]; RE0002642. RX PUBMED: 3672126. RA Benbrook D., Pfahl M. RT A novel thyroid hormone receptor encoded by a cDNA clone from a human testis library RL Science 238:788-791 (1987). RN [5]; RE0047529. RX PUBMED: 11641275. RA Potter G. B., Beaudoin GM 3. r. d., DeRenzo C. L., Zarach J. M., Chen S. H., Thompson C. C. RT The hairless gene mutated in congenital hair loss disorders encodes a novel nuclear receptor corepressor. RL Genes Dev. 15:2687-2701 (2001). RN [6]; RE0054989. RX PUBMED: 15604093. RA Albers M., Kranz H., Kober I., Kaiser C., Klink M., Suckow J., Kern R., Koegl M. RT Automated yeast two-hybrid screening for nuclear receptor-interacting proteins. RL Mol. Cell. Proteomics 4:205-213 (2005). RN [7]; RE0066219. RX PUBMED: 18641393. RA Grespin M. E., Bonamy G. M., Roggero V. R., Cameron N. G., Adam L. E., Atchison A. P., Fratto V. M., Allison L. A. RT Thyroid hormone receptor alpha1 follows a cooperative CRM1/calreticulin-mediated nuclear export pathway. RL J. Biol. Chem. 283:25576-25588 (2008). XX //